DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42498 and Lage3

DIOPT Version :9

Sequence 1:NP_001163743.1 Gene:CG42498 / 8674046 FlyBaseID:FBgn0260224 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_079686.1 Gene:Lage3 / 66192 MGIID:1913442 Length:148 Species:Mus musculus


Alignment Length:72 Identity:28/72 - (38%)
Similarity:38/72 - (52%) Gaps:0/72 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VPFETPRLAEIAYKVLGVDQEPRRNFVKKTLSLENDVLVVHFQSDQVKSLRTAITSFFECLLLCQ 80
            |||.|...||||...|..|.||.|..|.|.|.:...:|.|.:.::..:.||.:|.:|.:.|.|..
Mouse    72 VPFPTSLEAEIACGSLVPDVEPHRGLVGKELKVSGCMLEVRWIAEDSRLLRLSIINFLDQLSLVV 136

  Fly    81 DTINQFG 87
            :||..||
Mouse   137 NTIQLFG 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42498NP_001163743.1 Pcc1 14..84 CDD:286431 25/67 (37%)
Lage3NP_079686.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
Pcc1 68..140 CDD:286431 25/67 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847007
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CZV3
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005842
OrthoInspector 1 1.000 - - oto94198
orthoMCL 1 0.900 - - OOG6_104774
Panther 1 1.100 - - LDO PTHR31283
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R7158
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.