DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tcs6 and Ctag2l1

DIOPT Version :10

Sequence 1:NP_001163743.1 Gene:Tcs6 / 8674046 FlyBaseID:FBgn0260224 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_001092775.1 Gene:Ctag2l1 / 628456 MGIID:3644285 Length:208 Species:Mus musculus


Alignment Length:79 Identity:20/79 - (25%)
Similarity:39/79 - (49%) Gaps:0/79 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 NKPNESIIRVPFETPRLAEIAYKVLGVDQEPRRNFVKKTLSLENDVLVVHFQSDQVKSLRTAITS 71
            |:..|..:.|||.|...|::|.:.|..:..|::..|::..:..:.:|.|.:.:|.....|.:|.:
Mouse   113 NRSLEFSVTVPFRTAVEADMARRSLVANAHPQQVMVQQEFTANDSILAVRWTTDDPFLFRISINT 177

  Fly    72 FFECLLLCQDTINQ 85
            |.:.|.|....|.:
Mouse   178 FLDQLSLVMRNIQR 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tcs6NP_001163743.1 Pcc1 14..84 CDD:462764 17/69 (25%)
Ctag2l1NP_001092775.1 Pcc1 117..190 CDD:462764 18/72 (25%)

Return to query results.
Submit another query.