DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42498 and Ctag2l1

DIOPT Version :9

Sequence 1:NP_001163743.1 Gene:CG42498 / 8674046 FlyBaseID:FBgn0260224 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_001092775.1 Gene:Ctag2l1 / 628456 MGIID:3644285 Length:208 Species:Mus musculus


Alignment Length:79 Identity:20/79 - (25%)
Similarity:39/79 - (49%) Gaps:0/79 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 NKPNESIIRVPFETPRLAEIAYKVLGVDQEPRRNFVKKTLSLENDVLVVHFQSDQVKSLRTAITS 71
            |:..|..:.|||.|...|::|.:.|..:..|::..|::..:..:.:|.|.:.:|.....|.:|.:
Mouse   113 NRSLEFSVTVPFRTAVEADMARRSLVANAHPQQVMVQQEFTANDSILAVRWTTDDPFLFRISINT 177

  Fly    72 FFECLLLCQDTINQ 85
            |.:.|.|....|.:
Mouse   178 FLDQLSLVMRNIQR 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42498NP_001163743.1 Pcc1 14..84 CDD:286431 17/69 (25%)
Ctag2l1NP_001092775.1 MSP1_C <56..>107 CDD:284802
Pcc1 118..190 CDD:286431 17/71 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847006
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR31283
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.