DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tcs6 and CTAG2

DIOPT Version :10

Sequence 1:NP_001163743.1 Gene:Tcs6 / 8674046 FlyBaseID:FBgn0260224 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_066274.2 Gene:CTAG2 / 30848 HGNCID:2492 Length:210 Species:Homo sapiens


Alignment Length:54 Identity:15/54 - (27%)
Similarity:27/54 - (50%) Gaps:6/54 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ANKPNESI----IRVPFETPRLAEIAYKVLGVDQE--PRRNFVKKTLSLENDVL 53
            |.:|:..:    |.:||.:|..||:..::|..|..  ||...|.|..::..::|
Human    80 ARRPDSRLLELHITMPFSSPMEAELVRRILSRDAAPLPRPGAVLKDFTVSGNLL 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tcs6NP_001163743.1 Pcc1 14..84 CDD:462764 13/42 (31%)
CTAG2NP_066274.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..80 15/54 (28%)
Pcc1 89..>141 CDD:462764 13/45 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 154..197
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.