DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42498 and Lage3

DIOPT Version :9

Sequence 1:NP_001163743.1 Gene:CG42498 / 8674046 FlyBaseID:FBgn0260224 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_001099815.1 Gene:Lage3 / 293863 RGDID:1562476 Length:148 Species:Rattus norvegicus


Alignment Length:72 Identity:29/72 - (40%)
Similarity:40/72 - (55%) Gaps:0/72 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VPFETPRLAEIAYKVLGVDQEPRRNFVKKTLSLENDVLVVHFQSDQVKSLRTAITSFFECLLLCQ 80
            |||.|...||||...|..|.||.:..|:|.|.:...||.||:.::..:.||.:|.:|.:.|.|..
  Rat    72 VPFPTSLEAEIACGSLAPDVEPHQGLVEKELKVSGSVLEVHWIAEDSRLLRISIMNFLDQLSLVV 136

  Fly    81 DTINQFG 87
            :||..||
  Rat   137 NTIQLFG 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42498NP_001163743.1 Pcc1 14..84 CDD:286431 26/67 (39%)
Lage3NP_001099815.1 Pcc1 67..140 CDD:401328 26/67 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350515
Domainoid 1 1.000 46 1.000 Domainoid score I11781
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005842
OrthoInspector 1 1.000 - - oto97723
orthoMCL 1 0.900 - - OOG6_104774
Panther 1 1.100 - - LDO PTHR31283
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.840

Return to query results.
Submit another query.