DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42498 and CTAG1A

DIOPT Version :9

Sequence 1:NP_001163743.1 Gene:CG42498 / 8674046 FlyBaseID:FBgn0260224 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_640343.1 Gene:CTAG1A / 246100 HGNCID:24198 Length:180 Species:Homo sapiens


Alignment Length:70 Identity:18/70 - (25%)
Similarity:34/70 - (48%) Gaps:2/70 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ESIIRVPFETPRLAEIAYKVLGVDQEPR--RNFVKKTLSLENDVLVVHFQSDQVKSLRTAITSFF 73
            |..:.:||.||..||:|.:.|..|..|.  ...:.|..::..::|.:...:...:.|:.:|:|..
Human    89 EFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCL 153

  Fly    74 ECLLL 78
            :.|.|
Human   154 QQLSL 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42498NP_001163743.1 Pcc1 14..84 CDD:286431 17/67 (25%)
CTAG1ANP_640343.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..66
Pcc1 92..162 CDD:312741 17/67 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156596
Domainoid 1 1.000 47 1.000 Domainoid score I12039
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I5441
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR31283
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.080

Return to query results.
Submit another query.