powered by:
Protein Alignment CG42498 and CTAG1A
DIOPT Version :9
Sequence 1: | NP_001163743.1 |
Gene: | CG42498 / 8674046 |
FlyBaseID: | FBgn0260224 |
Length: | 111 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_640343.1 |
Gene: | CTAG1A / 246100 |
HGNCID: | 24198 |
Length: | 180 |
Species: | Homo sapiens |
Alignment Length: | 70 |
Identity: | 18/70 - (25%) |
Similarity: | 34/70 - (48%) |
Gaps: | 2/70 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 11 ESIIRVPFETPRLAEIAYKVLGVDQEPR--RNFVKKTLSLENDVLVVHFQSDQVKSLRTAITSFF 73
|..:.:||.||..||:|.:.|..|..|. ...:.|..::..::|.:...:...:.|:.:|:|..
Human 89 EFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCL 153
Fly 74 ECLLL 78
:.|.|
Human 154 QQLSL 158
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C165156596 |
Domainoid |
1 |
1.000 |
47 |
1.000 |
Domainoid score |
I12039 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
54 |
1.000 |
Inparanoid score |
I5441 |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR31283 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
4 | 4.080 |
|
Return to query results.
Submit another query.