powered by:
Protein Alignment CG42498 and PCC1
DIOPT Version :9
Sequence 1: | NP_001163743.1 |
Gene: | CG42498 / 8674046 |
FlyBaseID: | FBgn0260224 |
Length: | 111 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_878113.4 |
Gene: | PCC1 / 1500489 |
SGDID: | S000028512 |
Length: | 88 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 63 |
Identity: | 21/63 - (33%) |
Similarity: | 35/63 - (55%) |
Gaps: | 0/63 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 14 IRVPFETPRLAEIAYKVLGVDQEPRRNFVKKTLSLENDVLVVHFQSDQVKSLRTAITSFFECL 76
:::||||.|.|.||.|||..|...:....:...|.|.:|::|.|:|...:.||..::|..:.:
Yeast 15 LKIPFETERQATIATKVLSPDPILKPQDFQVDYSSEKNVMLVQFRSIDDRVLRVGVSSIIDSI 77
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG42498 | NP_001163743.1 |
Pcc1 |
14..84 |
CDD:286431 |
21/63 (33%) |
PCC1 | NP_878113.4 |
Pcc1 |
12..85 |
CDD:401328 |
21/63 (33%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0005842 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_104774 |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR31283 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R7158 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
5 | 4.940 |
|
Return to query results.
Submit another query.