DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42498 and lage3

DIOPT Version :9

Sequence 1:NP_001163743.1 Gene:CG42498 / 8674046 FlyBaseID:FBgn0260224 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_001373734.1 Gene:lage3 / 100536597 -ID:- Length:96 Species:Danio rerio


Alignment Length:82 Identity:30/82 - (36%)
Similarity:48/82 - (58%) Gaps:0/82 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ANKPNESIIRVPFETPRLAEIAYKVLGVDQEPRRNFVKKTLSLENDVLVVHFQSDQVKSLRTAIT 70
            ||...|..::|||.|.|.|.||.:.|..|.|||:..:.|:|.:....|.|.:.:|:.:.||.:::
Zfish    10 ANGKLEFFLKVPFPTEREANIALQSLSPDPEPRKGGISKSLCVSGQTLSVSWAADEARILRVSVS 74

  Fly    71 SFFECLLLCQDTINQFG 87
            ||.:.|.|..:|::.||
Zfish    75 SFLDHLSLVMETMDAFG 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42498NP_001163743.1 Pcc1 14..84 CDD:286431 25/69 (36%)
lage3NP_001373734.1 Pcc1 15..88 CDD:401328 26/72 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592215
Domainoid 1 1.000 52 1.000 Domainoid score I11539
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I5413
OMA 1 1.010 - - QHG49528
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005842
OrthoInspector 1 1.000 - - oto39532
orthoMCL 1 0.900 - - OOG6_104774
Panther 1 1.100 - - LDO PTHR31283
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.900

Return to query results.
Submit another query.