DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42498 and lage3

DIOPT Version :9

Sequence 1:NP_001163743.1 Gene:CG42498 / 8674046 FlyBaseID:FBgn0260224 Length:111 Species:Drosophila melanogaster
Sequence 2:XP_002937978.1 Gene:lage3 / 100379978 XenbaseID:XB-GENE-5887193 Length:89 Species:Xenopus tropicalis


Alignment Length:72 Identity:31/72 - (43%)
Similarity:50/72 - (69%) Gaps:0/72 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VPFETPRLAEIAYKVLGVDQEPRRNFVKKTLSLENDVLVVHFQSDQVKSLRTAITSFFECLLLCQ 80
            |||.:.:.|||||..|..|.|||:..|.||||:.:::|.|::::|:.:.||.:::||.|.|.|..
 Frog    12 VPFPSSKEAEIAYNSLCPDAEPRKGGVSKTLSVTDNILHVNWKADEARILRVSVSSFLEHLSLVV 76

  Fly    81 DTINQFG 87
            .|:::||
 Frog    77 LTMDRFG 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42498NP_001163743.1 Pcc1 14..84 CDD:286431 29/67 (43%)
lage3XP_002937978.1 Pcc1 7..80 CDD:378151 29/67 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10918
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 60 1.000 Inparanoid score I5221
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005842
OrthoInspector 1 1.000 - - oto104407
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.050

Return to query results.
Submit another query.