powered by:
Protein Alignment CG42498 and lage3
DIOPT Version :9
Sequence 1: | NP_001163743.1 |
Gene: | CG42498 / 8674046 |
FlyBaseID: | FBgn0260224 |
Length: | 111 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_002937978.1 |
Gene: | lage3 / 100379978 |
XenbaseID: | XB-GENE-5887193 |
Length: | 89 |
Species: | Xenopus tropicalis |
Alignment Length: | 72 |
Identity: | 31/72 - (43%) |
Similarity: | 50/72 - (69%) |
Gaps: | 0/72 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 16 VPFETPRLAEIAYKVLGVDQEPRRNFVKKTLSLENDVLVVHFQSDQVKSLRTAITSFFECLLLCQ 80
|||.:.:.|||||..|..|.|||:..|.||||:.:::|.|::::|:.:.||.:::||.|.|.|..
Frog 12 VPFPSSKEAEIAYNSLCPDAEPRKGGVSKTLSVTDNILHVNWKADEARILRVSVSSFLEHLSLVV 76
Fly 81 DTINQFG 87
.|:::||
Frog 77 LTMDRFG 83
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG42498 | NP_001163743.1 |
Pcc1 |
14..84 |
CDD:286431 |
29/67 (43%) |
lage3 | XP_002937978.1 |
Pcc1 |
7..80 |
CDD:378151 |
29/67 (43%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
56 |
1.000 |
Domainoid score |
I10918 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
60 |
1.000 |
Inparanoid score |
I5221 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0005842 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
oto104407 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
5 | 5.050 |
|
Return to query results.
Submit another query.