DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr21 and nectin3a

DIOPT Version :10

Sequence 1:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster
Sequence 2:XP_073779583.1 Gene:nectin3a / 793240 ZFINID:ZDB-GENE-130530-670 Length:644 Species:Danio rerio


Alignment Length:224 Identity:51/224 - (22%)
Similarity:89/224 - (39%) Gaps:62/224 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 VTSLVGITGHLNCRIK---NLGNKTVSWIRHRDLHLLTVSESTYTSDQRFTSIYNKQTGD-WSLQ 121
            |||::|....|:||::   ||.....||.||....::|::.        |..:|.....| :|.:
Zfish    43 VTSVLGKNVTLSCRMEMSSNLSLTQSSWERHLPSGIITLAV--------FNPVYGTSVADEYSRR 99

  Fly   122 IKF--PQLR------------DSGIYECQVSTTPPVGYTMVFSVVEPITSILGGPEIYI------ 166
            :.|  |.:.            |.|:|.|:: .|..:|.....:.|:    ::..|::|:      
Zfish   100 VHFLKPSVHDVSIVLQGVGFADIGMYTCKM-VTFELGNMQASTNVD----VMVEPKVYVSPGSLS 159

  Fly   167 ---DLGSTVNLTCVIKHLPDPPISVQWNHNNQEINYDSPRGGVSVITEKGDITTSYLLIQRASIA 228
               |.|.|:..||..:. ..|...|.|..       |.| |..:|:|:.....|:..|:      
Zfish   160 LTADDGETLVATCTAER-GRPAAEVFWES-------DLP-GQTAVVTQSEPEGTTTTLV------ 209

  Fly   229 DSGQYTCLPSNA-NSKSVNVHILKGDHPA 256
               .|...|:.| :.:|::..:   .|||
Zfish   210 ---HYVLAPTRASHGRSLSCVV---RHPA 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr21NP_001163838.2 Ig 71..149 CDD:472250 22/95 (23%)
Ig strand C 82..86 CDD:409353 1/3 (33%)
Ig strand E 118..122 CDD:409353 1/3 (33%)
Ig strand F 132..137 CDD:409353 2/4 (50%)
Ig 169..249 CDD:472250 18/80 (23%)
Ig strand B 172..176 CDD:409353 0/3 (0%)
Ig strand C 187..191 CDD:409353 1/3 (33%)
Ig strand E 218..222 CDD:409353 0/3 (0%)
Ig strand F 232..237 CDD:409353 1/4 (25%)
Ig strand G 246..249 CDD:409353 0/2 (0%)
nectin3aXP_073779583.1 None

Return to query results.
Submit another query.