DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr21 and IGSF9

DIOPT Version :9

Sequence 1:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001128522.1 Gene:IGSF9 / 57549 HGNCID:18132 Length:1179 Species:Homo sapiens


Alignment Length:238 Identity:52/238 - (21%)
Similarity:80/238 - (33%) Gaps:70/238 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 VLDRGPYFDTSATKNVTSLVGITGH---LNCRIKNLGNK----TVSWIRHRDLHLLTVSESTYTS 103
            |:.:|.  |......|.|:||..|.   |.|.:.....:    .:.|:|...|..:.:....|:.
Human    13 VISQGA--DGRGKPEVVSVVGRAGESVVLGCDLLPPAGRPPLHVIEWLRFGFLLPIFIQFGLYSP 75

  Fly   104 --DQRFTSIYNKQTGDWSLQIKFPQLRDSGIYECQV----------------------------S 138
              |..:......|.|. ||||:..::.|.|.|||:|                            .
Human    76 RIDPDYVGRVRLQKGA-SLQIEGLRVEDQGWYECRVFFLDQHIPEDDFANGSWVHLTVNSPPQFQ 139

  Fly   139 TTPPVGYTMVFSVVEPITSILGGPEIYIDLGSTVNLTCVIKHLPDPPISVQWNHNNQEINYDSPR 203
            .|||.  .:....:||:|                 |.||.:..|.|  .|.|....:::.    :
Human   140 ETPPA--VLEVQELEPVT-----------------LRCVARGSPLP--HVTWKLRGKDLG----Q 179

  Fly   204 GGVSVITEKGDITTSYLLIQRASIADSGQYTCLPSNANSKSVN 246
            |...|..:.|.     |.|:|.....||.|||..|:....:.:
Human   180 GQGQVQVQNGT-----LRIRRVERGSSGVYTCQASSTEGSATH 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr21NP_001163838.2 Ig 71..149 CDD:299845 22/111 (20%)
IG_like 71..140 CDD:214653 19/102 (19%)
IG_like 162..249 CDD:214653 19/85 (22%)
IGc2 169..242 CDD:197706 19/72 (26%)
IGSF9NP_001128522.1 Ig 24..132 CDD:299845 24/108 (22%)
IG_like 28..110 CDD:214653 22/82 (27%)
I-set 136..223 CDD:254352 25/112 (22%)
Ig 154..220 CDD:143165 20/92 (22%)
Ig_3 226..305 CDD:290638
IG_like 233..319 CDD:214653
Ig 341..404 CDD:299845
IG_like 431..503 CDD:214653
Ig 436..500 CDD:143165
fn3 511..596 CDD:278470
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 606..626
FN3 625..715 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 767..919
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 940..988
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1015..1079
PDZ-binding. /evidence=ECO:0000250 1177..1179
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.