| Sequence 1: | NP_001163838.2 | Gene: | dpr21 / 8674044 | FlyBaseID: | FBgn0260995 | Length: | 282 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_009293693.1 | Gene: | igsf9bb / 569554 | ZFINID: | ZDB-GENE-091112-15 | Length: | 1439 | Species: | Danio rerio |
| Alignment Length: | 203 | Identity: | 55/203 - (27%) |
|---|---|---|---|
| Similarity: | 85/203 - (41%) | Gaps: | 29/203 - (14%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 45 RVLDRGPYFDTSATKNVTSLVGITGHLNCRIKNL-GNKTVSWIRHRDLHLLTVSESTYTSD-QRF 107
Fly 108 TSIYNKQTGDWSLQIKFPQLRDSGIYECQVSTT---PPVGYTMVFSVVEPITSILGGPEIYIDLG 169
Fly 170 STVNLTCVIKHLPDPPI-SVQWNHNNQEINYDSPRGGVSVITEKGDITTSYLLIQRASIADS-GQ 232
Fly 233 YTCLPSNA 240 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr21 | NP_001163838.2 | Ig | 71..149 | CDD:299845 | 21/82 (26%) |
| IG_like | 71..140 | CDD:214653 | 19/70 (27%) | ||
| IG_like | 162..249 | CDD:214653 | 23/81 (28%) | ||
| IGc2 | 169..242 | CDD:197706 | 20/74 (27%) | ||
| igsf9bb | XP_009293693.1 | IG_like | 30..113 | CDD:214653 | |
| Ig | 41..113 | CDD:143165 | |||
| IG_like | 144..223 | CDD:214653 | 1/2 (50%) | ||
| IGc2 | 151..208 | CDD:197706 | |||
| I-set | 227..319 | CDD:254352 | 25/103 (24%) | ||
| Ig | <263..319 | CDD:299845 | 16/67 (24%) | ||
| Ig_2 | 326..414 | CDD:290606 | 24/85 (28%) | ||
| IG_like | 329..403 | CDD:214653 | 23/82 (28%) | ||
| IG_like | 424..504 | CDD:214653 | |||
| Ig | 440..504 | CDD:299845 | |||
| FN3 | 509..604 | CDD:238020 | |||
| FN3 | 620..704 | CDD:238020 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||