DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr21 and dscama

DIOPT Version :9

Sequence 1:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster
Sequence 2:XP_021334866.1 Gene:dscama / 568643 ZFINID:ZDB-GENE-050310-7 Length:2025 Species:Danio rerio


Alignment Length:251 Identity:59/251 - (23%)
Similarity:98/251 - (39%) Gaps:46/251 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LKETCP----QHFRENVT---------------VTDLYLISENIVPMKRVLDRGPYFDTSATKNV 61
            ||...|    ..||::||               |.:::....|...:.|:..:.|.....:.:.|
Zfish   260 LKNNRPLESDSRFRQSVTGLLIERAQPSDTGSYVCEVWNSYGNAEVIGRLTVKEPLKAVVSPRKV 324

  Fly    62 TSLVGITGHLNCRIKNLGNKTVSWIRHRDLHLLTVSESTYTSDQRFTSIYNKQTGDWSLQIKFPQ 126
            ...||....|:|.:.......:||.|:.|       :....::.|...| ||:    :|.:....
Zfish   325 KGSVGSQVSLSCSVTGSDEFELSWYRNGD-------KINTGANIRMNGI-NKE----NLVMDGMA 377

  Fly   127 LRDSGIYECQVSTTPPVGYTMVFSVVEPITSILGGPEI-------YIDLGSTVNLTCVIKHLPDP 184
            ..|.|:|:|............|..::|.     |.|:|       .:.....|:|||.:|..|.|
Zfish   378 KSDGGVYQCFSRKAKMSAQDFVQVILED-----GTPKILSAFSEKVVGPNDFVSLTCHVKGTPQP 437

  Fly   185 PISVQWNHNNQEINYDSPRGGVSVITEKGDITTSYLLIQRASIADSGQYTCLPSNA 240
            .|:  |..:::.:..||....|..||.:|:: .|||.|....:.|||.|.|..:|:
Zfish   438 AIT--WTLDDEVVAKDSRHRIVHSITAEGNV-VSYLNISHIQVRDSGVYRCTCNNS 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr21NP_001163838.2 Ig 71..149 CDD:299845 15/77 (19%)
IG_like 71..140 CDD:214653 15/68 (22%)
IG_like 162..249 CDD:214653 27/86 (31%)
IGc2 169..242 CDD:197706 25/72 (35%)
dscamaXP_021334866.1 Ig 124..217 CDD:325142
I-set 236..311 CDD:254352 10/50 (20%)
IG_like 321..402 CDD:214653 19/92 (21%)
I-set 408..502 CDD:333254 27/86 (31%)
IGc2 524..579 CDD:197706
Ig 614..679 CDD:319273
Ig_DSCAM 708..787 CDD:143211
Ig 805..898 CDD:325142
FN3 894..988 CDD:238020
FN3 995..1092 CDD:238020
fn3 1100..1186 CDD:306538
fn3 1199..1282 CDD:306538
Ig 1312..1377 CDD:319273
fn3 1405..1471 CDD:306538
FN3 1492..1563 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.