DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr21 and NTM

DIOPT Version :10

Sequence 1:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001338930.1 Gene:NTM / 50863 HGNCID:17941 Length:367 Species:Homo sapiens


Alignment Length:184 Identity:53/184 - (28%)
Similarity:81/184 - (44%) Gaps:20/184 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 ATKNVTSLVGITGHLNCRIKNLGNKTVSWIRHRDLHLLTVSESTYTSDQRFTSIYNKQTGDWSLQ 121
            |..|||...|.:..|.|.|.|...: |:|:....  :|......:..|.|...:.|.|| .:|::
Human    41 AMDNVTVRQGESATLRCTIDNRVTR-VAWLNRST--ILYAGNDKWCLDPRVVLLSNTQT-QYSIE 101

  Fly   122 IKFPQLRDSGIYECQVSTTPPVGYTMVFSVVEPITSILG-GPEIYIDLGSTVNLTCVIKHLPDPP 185
            |:...:.|.|.|.|.|.|......:.|..:|:....|:. ..:|.|:.|:.::|||:....|:| 
Human   102 IQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVSPKIVEISSDISINEGNNISLTCIATGRPEP- 165

  Fly   186 ISVQWNHNNQEINYDSPRGGVSVITEKGDITTSYLLIQRASIADSGQYTCLPSN 239
             :|.|.|       .||: .|..::|     ..||.||..:...||.|.|..||
Human   166 -TVTWRH-------ISPK-AVGFVSE-----DEYLEIQGITREQSGDYECSASN 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr21NP_001163838.2 Ig 71..149 CDD:472250 20/77 (26%)
Ig strand C 82..86 CDD:409353 1/3 (33%)
Ig strand E 118..122 CDD:409353 1/3 (33%)
Ig strand F 132..137 CDD:409353 2/4 (50%)
Ig 169..249 CDD:472250 23/71 (32%)
Ig strand B 172..176 CDD:409353 1/3 (33%)
Ig strand C 187..191 CDD:409353 1/3 (33%)
Ig strand E 218..222 CDD:409353 2/3 (67%)
Ig strand F 232..237 CDD:409353 2/4 (50%)
Ig strand G 246..249 CDD:409353
NTMNP_001338930.1 Ig 44..132 CDD:472250 25/91 (27%)
Ig strand B 53..57 CDD:409353 1/3 (33%)
Ig strand C 65..69 CDD:409353 1/4 (25%)
Ig strand E 98..102 CDD:409353 1/3 (33%)
Ig strand F 112..117 CDD:409353 2/4 (50%)
Ig strand G 125..128 CDD:409353 0/2 (0%)
Ig_3 136..205 CDD:464046 24/83 (29%)
Ig 223..307 CDD:472250
Ig strand B 239..243 CDD:409353
Ig strand C 252..256 CDD:409353
Ig strand E 278..282 CDD:409353
Ig strand F 292..297 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.