DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr21 and dpr12

DIOPT Version :10

Sequence 1:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster


Alignment Length:306 Identity:105/306 - (34%)
Similarity:151/306 - (49%) Gaps:44/306 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IFLCI--LILKETCPQHFRENVTVTDLYLISENIVPMKRVLDRG-----------------PYFD 54
            :.||:  |:|..|.....:..:|..|          .|::..||                 |.|:
  Fly    24 LLLCLPTLLLATTLEPDQKSILTDND----------WKKLWMRGGINGDSKLDNNLDSSDSPMFE 78

  Fly    55 TS--ATKNVTSLVGITGHLNCRIKNLGN-----KTVSWIRHRDLHLLTVSESTYTSDQRFTSIYN 112
            .|  ...|.|..:|.|..|.|::..:..     ..:||||.||.|:|:.....||:|:||..::.
  Fly    79 DSELMAHNTTVQLGGTAFLVCKVSGVDRVGVNWNQISWIRRRDWHILSSGAQLYTNDERFAILHT 143

  Fly   113 KQTGDWSLQIKFPQLRDSGIYECQVSTTPPVGYTMVF---SVVEPITSILGGPEIYIDLGSTVNL 174
            ..:..|:|||||.|.||.|:|||||||  |.|....|   .||.|...|||..|:::|:|||:||
  Fly   144 PGSNMWTLQIKFVQRRDHGMYECQVST--PTGIISHFVNLQVVVPEAFILGSGELHVDMGSTINL 206

  Fly   175 TCVIKHLPDPPISVQWNHNNQEINYDSPRGGVSVITEKGDITTSYLLIQRASIADSGQYTCLPSN 239
            .|:|:..|.||..|.|..|::.|||...|..:::.|..|..|.|.|:|:...:.|||.|||..||
  Fly   207 VCIIEKSPTPPQYVYWQKNDRLINYVDSRRDITIETTPGPRTQSRLIIREPQVTDSGNYTCSASN 271

  Fly   240 ANSKSVNVHILKGDHPAAVQKSHLLVSELLSLCF---LQICLNLST 282
            ....|:.|.:.|||:.||:.:.....::.|:..|   |..||.|:|
  Fly   272 TEPASIYVFVSKGDNMAAISRRKTSSADRLTHIFRSMLAPCLLLNT 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr21NP_001163838.2 Ig 71..149 CDD:472250 34/82 (41%)
Ig strand C 82..86 CDD:409353 1/3 (33%)
Ig strand E 118..122 CDD:409353 2/3 (67%)
Ig strand F 132..137 CDD:409353 3/4 (75%)
Ig 169..249 CDD:472250 33/79 (42%)
Ig strand B 172..176 CDD:409353 2/3 (67%)
Ig strand C 187..191 CDD:409353 1/3 (33%)
Ig strand E 218..222 CDD:409353 2/3 (67%)
Ig strand F 232..237 CDD:409353 3/4 (75%)
Ig strand G 246..249 CDD:409353 1/2 (50%)
dpr12NP_652462.3 IG_like 86..183 CDD:214653 39/98 (40%)
Ig strand B 95..99 CDD:409353 1/3 (33%)
Ig strand C 109..117 CDD:409353 1/7 (14%)
Ig strand E 149..153 CDD:409353 2/3 (67%)
Ig strand F 163..168 CDD:409353 3/4 (75%)
Ig strand G 176..179 CDD:409353 0/2 (0%)
Ig_3 195..271 CDD:464046 31/75 (41%)

Return to query results.
Submit another query.