DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr21 and dpr12

DIOPT Version :9

Sequence 1:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster


Alignment Length:306 Identity:105/306 - (34%)
Similarity:151/306 - (49%) Gaps:44/306 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IFLCI--LILKETCPQHFRENVTVTDLYLISENIVPMKRVLDRG-----------------PYFD 54
            :.||:  |:|..|.....:..:|..|          .|::..||                 |.|:
  Fly    24 LLLCLPTLLLATTLEPDQKSILTDND----------WKKLWMRGGINGDSKLDNNLDSSDSPMFE 78

  Fly    55 TS--ATKNVTSLVGITGHLNCRIKNLGN-----KTVSWIRHRDLHLLTVSESTYTSDQRFTSIYN 112
            .|  ...|.|..:|.|..|.|::..:..     ..:||||.||.|:|:.....||:|:||..::.
  Fly    79 DSELMAHNTTVQLGGTAFLVCKVSGVDRVGVNWNQISWIRRRDWHILSSGAQLYTNDERFAILHT 143

  Fly   113 KQTGDWSLQIKFPQLRDSGIYECQVSTTPPVGYTMVF---SVVEPITSILGGPEIYIDLGSTVNL 174
            ..:..|:|||||.|.||.|:|||||||  |.|....|   .||.|...|||..|:::|:|||:||
  Fly   144 PGSNMWTLQIKFVQRRDHGMYECQVST--PTGIISHFVNLQVVVPEAFILGSGELHVDMGSTINL 206

  Fly   175 TCVIKHLPDPPISVQWNHNNQEINYDSPRGGVSVITEKGDITTSYLLIQRASIADSGQYTCLPSN 239
            .|:|:..|.||..|.|..|::.|||...|..:::.|..|..|.|.|:|:...:.|||.|||..||
  Fly   207 VCIIEKSPTPPQYVYWQKNDRLINYVDSRRDITIETTPGPRTQSRLIIREPQVTDSGNYTCSASN 271

  Fly   240 ANSKSVNVHILKGDHPAAVQKSHLLVSELLSLCF---LQICLNLST 282
            ....|:.|.:.|||:.||:.:.....::.|:..|   |..||.|:|
  Fly   272 TEPASIYVFVSKGDNMAAISRRKTSSADRLTHIFRSMLAPCLLLNT 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr21NP_001163838.2 Ig 71..149 CDD:299845 34/82 (41%)
IG_like 71..140 CDD:214653 31/73 (42%)
IG_like 162..249 CDD:214653 35/86 (41%)
IGc2 169..242 CDD:197706 31/72 (43%)
dpr12NP_652462.3 IG 86..183 CDD:214652 39/98 (40%)
Ig_3 193..271 CDD:404760 31/77 (40%)
Ig strand B 204..208 CDD:409353 2/3 (67%)
Ig strand C 219..223 CDD:409353 1/3 (33%)
Ig strand E 250..254 CDD:409353 2/3 (67%)
Ig strand F 264..269 CDD:409353 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
66.060

Return to query results.
Submit another query.