DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr21 and opcml

DIOPT Version :9

Sequence 1:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001005580.1 Gene:opcml / 449538 ZFINID:ZDB-GENE-040927-3 Length:342 Species:Danio rerio


Alignment Length:213 Identity:52/213 - (24%)
Similarity:98/213 - (46%) Gaps:27/213 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 DTSATKNVTSLVGITGHLNCRIKNLGNKTVSWIRHRDLHLLTVSESTYTSDQRFTSIYNKQTGDW 118
            |:....|:|...|.:..|.|.:.|..:: |:|: :|...|.|.:|. ::.|.|.. :.|....::
Zfish    35 DSYLKDNITVRQGDSAVLKCSMDNKVSR-VAWL-NRTTILFTGNEK-WSLDPRVV-LLNTAVNEY 95

  Fly   119 SLQIKFPQLRDSGIYECQVSTTPPVGYTMVFSVVE-PITSILGGPEIYIDLGSTVNLTCVIKHLP 182
            |::|....|.|.|.|.|.:.|......|.|..:|: |...:....::.::.||.|:|.|:....|
Zfish    96 SIKILNVNLYDEGPYVCSILTNKKPESTKVHLIVQVPARIVNVSTDVSVNEGSNVSLMCLAIGRP 160

  Fly   183 DPPISVQWNHNNQEINYDSPRGGVSVITEKGDITTSYLLIQRASIADSGQYTCLPSNANS----K 243
            :|  |:.|...:.:        |..::|| |:    |:.:...:...||.|.|:.||..|    :
Zfish   161 EP--SILWKFRSSK--------GNRIVTE-GE----YVEMTGITKDMSGSYDCITSNDISPPDVR 210

  Fly   244 SVNVHILKGDHPAAVQKS 261
            :|.|.:   ::|..:.::
Zfish   211 TVQVTV---NYPPVISRA 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr21NP_001163838.2 Ig 71..149 CDD:299845 21/77 (27%)
IG_like 71..140 CDD:214653 19/68 (28%)
IG_like 162..249 CDD:214653 23/90 (26%)
IGc2 169..242 CDD:197706 20/72 (28%)
opcmlNP_001005580.1 Ig 41..129 CDD:299845 25/91 (27%)
IG_like 41..129 CDD:214653 25/91 (27%)
IG_like 139..216 CDD:214653 23/91 (25%)
IGc2 146..202 CDD:197706 18/70 (26%)
I-set 219..307 CDD:254352 1/7 (14%)
ig 223..307 CDD:278476 0/3 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.