DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr21 and opcml

DIOPT Version :10

Sequence 1:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001005580.1 Gene:opcml / 449538 ZFINID:ZDB-GENE-040927-3 Length:342 Species:Danio rerio


Alignment Length:213 Identity:52/213 - (24%)
Similarity:98/213 - (46%) Gaps:27/213 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 DTSATKNVTSLVGITGHLNCRIKNLGNKTVSWIRHRDLHLLTVSESTYTSDQRFTSIYNKQTGDW 118
            |:....|:|...|.:..|.|.:.|..:: |:|: :|...|.|.:|. ::.|.|.. :.|....::
Zfish    35 DSYLKDNITVRQGDSAVLKCSMDNKVSR-VAWL-NRTTILFTGNEK-WSLDPRVV-LLNTAVNEY 95

  Fly   119 SLQIKFPQLRDSGIYECQVSTTPPVGYTMVFSVVE-PITSILGGPEIYIDLGSTVNLTCVIKHLP 182
            |::|....|.|.|.|.|.:.|......|.|..:|: |...:....::.::.||.|:|.|:....|
Zfish    96 SIKILNVNLYDEGPYVCSILTNKKPESTKVHLIVQVPARIVNVSTDVSVNEGSNVSLMCLAIGRP 160

  Fly   183 DPPISVQWNHNNQEINYDSPRGGVSVITEKGDITTSYLLIQRASIADSGQYTCLPSNANS----K 243
            :|  |:.|...:.:        |..::|| |:    |:.:...:...||.|.|:.||..|    :
Zfish   161 EP--SILWKFRSSK--------GNRIVTE-GE----YVEMTGITKDMSGSYDCITSNDISPPDVR 210

  Fly   244 SVNVHILKGDHPAAVQKS 261
            :|.|.:   ::|..:.::
Zfish   211 TVQVTV---NYPPVISRA 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr21NP_001163838.2 Ig 71..149 CDD:472250 21/77 (27%)
Ig strand C 82..86 CDD:409353 1/3 (33%)
Ig strand E 118..122 CDD:409353 1/3 (33%)
Ig strand F 132..137 CDD:409353 2/4 (50%)
Ig 169..249 CDD:472250 23/83 (28%)
Ig strand B 172..176 CDD:409353 2/3 (67%)
Ig strand C 187..191 CDD:409353 1/3 (33%)
Ig strand E 218..222 CDD:409353 1/3 (33%)
Ig strand F 232..237 CDD:409353 2/4 (50%)
Ig strand G 246..249 CDD:409353 1/2 (50%)
opcmlNP_001005580.1 Ig 41..129 CDD:472250 25/91 (27%)
Ig strand B 50..54 CDD:409353 1/3 (33%)
Ig strand C 62..66 CDD:409353 1/4 (25%)
Ig strand E 95..99 CDD:409353 1/3 (33%)
Ig strand F 109..114 CDD:409353 2/4 (50%)
Ig strand G 122..125 CDD:409353 1/2 (50%)
Ig 128..214 CDD:472250 24/100 (24%)
Ig strand B 150..154 CDD:409353 2/3 (67%)
Ig strand C 163..167 CDD:409353 1/3 (33%)
Ig strand E 181..185 CDD:409353 1/7 (14%)
Ig strand F 195..200 CDD:409353 2/4 (50%)
Ig 220..308 CDD:472250 0/6 (0%)
Ig strand B 236..240 CDD:409353
Ig strand C 249..253 CDD:409353
Ig strand E 275..279 CDD:409353
Ig strand F 289..294 CDD:409353
Ig strand G 302..305 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.