DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr21 and klg

DIOPT Version :10

Sequence 1:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_524454.2 Gene:klg / 42707 FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster


Alignment Length:310 Identity:64/310 - (20%)
Similarity:101/310 - (32%) Gaps:119/310 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 MKRVLDRGPYFDTSATKNVTSLVGITGHLNCRIKNLGNKTVSWIRHRDLHLLTVSESTYTSDQRF 107
            :.|.|.||..:        .::||.|..|.|:::||||..:.|  .|..::||.|....|.|:|.
  Fly   100 LPRFLSRGHTY--------RAVVGDTLVLPCQVENLGNFVLLW--RRGTNVLTASNIMVTRDERV 154

  Fly   108 TSI--YNKQTGDWSLQIKFPQLRDSGIYECQVS-------------TTPP--------------- 142
            ..|  ||.:..|..     ||  |:|.|.||:|             ..||               
  Fly   155 RLIDGYNLEISDLE-----PQ--DAGDYVCQISDKINRDQVHTVEILVPPSVRAIPTSGQLQARK 212

  Fly   143 --------------------------------VGYTMVFS-------------------VVEPIT 156
                                            :|...:.:                   |.:|:|
  Fly   213 GGPITLECKGSGNPVPSIYWTKKSGANKSTARIGDGPILTLEKLERQQAGVYQCTADNGVGDPVT 277

  Fly   157 -----SILGGPEIYIDL-------GSTVNLTCVIKHLPDPPISVQWNHNNQEINYDSPRGGVSVI 209
                 .:|..|:|.::.       |....|.|::  ..||..:|.|..|:..|.....|    ::
  Fly   278 VDMRLDVLYPPDIQVEKSWIHSGEGFEAKLVCIV--FADPVATVSWYQNSFPIQSTDRR----IM 336

  Fly   210 TEKGDITTSYLLIQRASIADSGQYTCLPSNANSKSVNVHILKGDHPAAVQ 259
            ..:.:  ...|.|:.....|.|.|:|:..|:..:|.....|.| .|.|.:
  Fly   337 ATRAN--RHMLTIRHIQQEDFGNYSCVADNSLGRSRKYMELSG-RPGAAE 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr21NP_001163838.2 Ig 71..149 CDD:472250 29/139 (21%)
Ig strand C 82..86 CDD:409353 0/3 (0%)
Ig strand E 118..122 CDD:409353 0/3 (0%)
Ig strand F 132..137 CDD:409353 2/4 (50%)
Ig 169..249 CDD:472250 18/79 (23%)
Ig strand B 172..176 CDD:409353 1/3 (33%)
Ig strand C 187..191 CDD:409353 1/3 (33%)
Ig strand E 218..222 CDD:409353 1/3 (33%)
Ig strand F 232..237 CDD:409353 2/4 (50%)
Ig strand G 246..249 CDD:409353 0/2 (0%)
klgNP_524454.2 IG_like 109..195 CDD:214653 29/102 (28%)
Ig strand B 118..122 CDD:409353 1/3 (33%)
Ig strand C 131..135 CDD:409353 1/5 (20%)
Ig strand E 160..164 CDD:409353 2/3 (67%)
Ig strand F 174..179 CDD:409353 2/4 (50%)
Ig strand G 188..191 CDD:409353 0/2 (0%)
Ig_3 196..270 CDD:464046 3/73 (4%)
Ig_3 287..364 CDD:464046 18/84 (21%)
FN3 392..486 CDD:238020
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.