DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr21 and dpr15

DIOPT Version :9

Sequence 1:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster


Alignment Length:410 Identity:93/410 - (22%)
Similarity:138/410 - (33%) Gaps:188/410 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 PYFDTSATKNVTSLVGITGHLNCRIKNLGNKTVSWIRHRDLHLLTVSESTYTSDQRFTSIYNKQT 115
            |..|...|  :.|..|...:|.|.:|.|..|.:||:|.||.|:|||.::|:.:||||.|:::...
  Fly   191 PTIDDYQT--IISQAGTHAYLPCNVKQLVKKPISWLRMRDGHILTVDQTTFIADQRFQSVFSPNP 253

  Fly   116 GDWSLQIKFPQLRDSGIYECQVSTTPPVGYTMVFSVVEPITSILGGPEIYIDLGSTVNLTCVIKH 180
            ..||||||:.||:|.|.|||||||.|.....:...:|||.|.::|....::..||.|.|.|:|..
  Fly   254 ERWSLQIKYVQLKDEGTYECQVSTEPKASAIVHLRIVEPKTELIGESTRHVKAGSQVKLRCIISQ 318

  Fly   181 LPDPPISVQWNHNNQEINYDSPRG----------------------------------------- 204
            ..:||:.:.|.:|.::|...:.||                                         
  Fly   319 ALEPPLFINWFYNQKQIYLHNRRGWRTEIERIDLPAEVPTTSTTTTTTTTTASTTTTTTSTTPAT 383

  Fly   205 ---------------------------------------------GVSVITE------------- 211
                                                         ||:|.||             
  Fly   384 PSTTATGSTEGATSSETLNGLVTITRSYILDAISQNDVSELGAAAGVAVATETSTAQLLTEVEAT 448

  Fly   212 --------------------------------KGD------------------------------ 214
                                            .||                              
  Fly   449 SSTSGTSTGAGLLASTSAAYAAGAAAGITTAATGDSAATAATTSAWLTTMDAEAATTAATTTTTM 513

  Fly   215 ---------ITTSYLLIQRASIADSGQYTCLPSNANSKSVNVHILKGDHPAAVQKSHLL------ 264
                     |||:.|:|......|||.|||.|||:..:::.:|:|.|::.|:..||..:      
  Fly   514 LPSSSFIKQITTASLIIPAVVKLDSGNYTCSPSNSAPRTIVLHVLNGEYSASAIKSGSVSWSALI 578

  Fly   265 ----------VSELLSLCFL 274
                      ||.||:|.::
  Fly   579 GCHGYLHWRNVSTLLTLLWI 598

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr21NP_001163838.2 Ig 71..149 CDD:299845 38/77 (49%)
IG_like 71..140 CDD:214653 36/68 (53%)
IG_like 162..249 CDD:214653 34/256 (13%)
IGc2 169..242 CDD:197706 34/242 (14%)
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 41/93 (44%)
V-set 204..290 CDD:284989 39/85 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444706
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5236
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.