Sequence 1: | NP_001163838.2 | Gene: | dpr21 / 8674044 | FlyBaseID: | FBgn0260995 | Length: | 282 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001287299.1 | Gene: | dpr15 / 41473 | FlyBaseID: | FBgn0037993 | Length: | 662 | Species: | Drosophila melanogaster |
Alignment Length: | 410 | Identity: | 93/410 - (22%) |
---|---|---|---|
Similarity: | 138/410 - (33%) | Gaps: | 188/410 - (45%) |
- Green bases have known domain annotations that are detailed below.
Fly 51 PYFDTSATKNVTSLVGITGHLNCRIKNLGNKTVSWIRHRDLHLLTVSESTYTSDQRFTSIYNKQT 115
Fly 116 GDWSLQIKFPQLRDSGIYECQVSTTPPVGYTMVFSVVEPITSILGGPEIYIDLGSTVNLTCVIKH 180
Fly 181 LPDPPISVQWNHNNQEINYDSPRG----------------------------------------- 204
Fly 205 ---------------------------------------------GVSVITE------------- 211
Fly 212 --------------------------------KGD------------------------------ 214
Fly 215 ---------ITTSYLLIQRASIADSGQYTCLPSNANSKSVNVHILKGDHPAAVQKSHLL------ 264
Fly 265 ----------VSELLSLCFL 274 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr21 | NP_001163838.2 | Ig | 71..149 | CDD:299845 | 38/77 (49%) |
IG_like | 71..140 | CDD:214653 | 36/68 (53%) | ||
IG_like | 162..249 | CDD:214653 | 34/256 (13%) | ||
IGc2 | 169..242 | CDD:197706 | 34/242 (14%) | ||
dpr15 | NP_001287299.1 | IG_like | 197..289 | CDD:214653 | 41/93 (44%) |
V-set | 204..290 | CDD:284989 | 39/85 (46%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45444706 | |
Domainoid | 1 | 1.000 | 42 | 1.000 | Domainoid score | I12424 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 79 | 1.000 | Inparanoid score | I5236 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000207 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR23279 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
6 | 5.990 |