DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr21 and dpr5

DIOPT Version :9

Sequence 1:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster


Alignment Length:271 Identity:106/271 - (39%)
Similarity:152/271 - (56%) Gaps:21/271 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FLCILILKE-TCP---------QHFRENVTVTDLYLISENIVPMK-RVLDRGPYFDTSATKNVTS 63
            |:.:|::.. |.|         |:|.......:|    .|::|.. ..:|  |.||.:..:.|.:
  Fly    44 FMALLVIMGLTAPVDKQSRRSSQYFGHLAAAEEL----SNLIPDNYDAID--PVFDNTTDREVIA 102

  Fly    64 LVGITGHLNCRIKNLGNKTVSWIRHRDLHLLTVSESTYTSDQRFTSIYNKQTGDWSLQIKFPQLR 128
            .:|.|..|:||:::||::.|||||.||||:||:...|||:||||.:.:...:.:|.|:|...|.|
  Fly   103 ALGTTARLHCRVRHLGDRAVSWIRQRDLHILTIGIMTYTNDQRFLARHIDNSDEWVLKIVSVQQR 167

  Fly   129 DSGIYECQVSTTPPVGYTMVFSVVEPITSILGGPEIYIDLGSTVNLTCVIKHLPDPPISVQWNHN 193
            |:|:|||||||.|.:.......||.....||...|::|..||.:||||:....|.|...:.| |.
  Fly   168 DAGVYECQVSTEPKISLAYKLVVVTSKAQILANRELFIQSGSDINLTCIAPQAPGPYTHMLW-HK 231

  Fly   194 NQEINYDSPRGGVSVITEKGDITTSYLLIQRASIADSGQYTCLPSNANSKSVNVHILKGDHPAAV 258
            :.|:..||.|||:.|.:|: .:.||.|:|.|....|||.|||...|:||.||.|||:|.:..||:
  Fly   232 DTELVSDSARGGIRVESEQ-QMKTSNLVISRVQHTDSGNYTCSADNSNSDSVFVHIIKSEQHAAM 295

  Fly   259 QKSHLLVSELL 269
            |  |.|.|.||
  Fly   296 Q--HELGSRLL 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr21NP_001163838.2 Ig 71..149 CDD:299845 38/77 (49%)
IG_like 71..140 CDD:214653 36/68 (53%)
IG_like 162..249 CDD:214653 37/86 (43%)
IGc2 169..242 CDD:197706 30/72 (42%)
dpr5NP_650080.3 V-set 95..191 CDD:284989 41/95 (43%)
IG_like 98..179 CDD:214653 39/80 (49%)
IG_like 206..278 CDD:214653 30/73 (41%)
Ig 211..278 CDD:143165 28/68 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444744
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.