DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr21 and dpr11

DIOPT Version :10

Sequence 1:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_788586.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster


Alignment Length:237 Identity:96/237 - (40%)
Similarity:138/237 - (58%) Gaps:9/237 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 PYFDTSATKNVTSLVGITGHLNCRIKNLGNKTVSWIRHRDLHLLTVSESTYTSDQRFTSIYNKQT 115
            ||.|..||.|||:.:|...:|.||:|.||||:|||||.||.|:|||..:.:.:||||.:|  ||.
  Fly   117 PYLDGYATSNVTTQIGTHAYLPCRVKQLGNKSVSWIRLRDGHILTVDRAVFIADQRFLAI--KQP 179

  Fly   116 GD-WSLQIKFPQLRDSGIYECQVSTTPPVGYTMVFSVVEPITSILGGPEIYIDLGSTVNLTCVIK 179
            .. |:||||:.|.||:|.|||||||.|.|...:...||.|.|.|||.|:.|:..||.|.|.|:::
  Fly   180 DKYWTLQIKYVQARDAGSYECQVSTEPKVSARVQLQVVVPRTEILGEPDRYVKAGSNVVLRCIVR 244

  Fly   180 HLPDPPISVQWNHNNQEINYDSPRGGVSV------ITEKGDITTSYLLIQRASIADSGQYTCLPS 238
            ...:||..:.|.|..:::..||.|....:      .:.:|..|...|:|:.|...|:|.|||.||
  Fly   245 GALEPPTFIMWYHGAEQLAADSRRHRTQLDPNLPEASGEGQSTIGSLIIESAKKRDTGNYTCSPS 309

  Fly   239 NANSKSVNVHILKGDHPAAVQKSHLLVSELLSLCFLQICLNL 280
            |:.|.:|.::|:.|:..|:...|....:...:|..|.:.|::
  Fly   310 NSPSATVTLNIINGESSASAVTSSAATTRAYALSILALLLSV 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr21NP_001163838.2 Ig 71..149 CDD:472250 44/78 (56%)
Ig strand C 82..86 CDD:409353 2/3 (67%)
Ig strand E 118..122 CDD:409353 2/3 (67%)
Ig strand F 132..137 CDD:409353 3/4 (75%)
Ig 169..249 CDD:472250 27/85 (32%)
Ig strand B 172..176 CDD:409353 2/3 (67%)
Ig strand C 187..191 CDD:409353 0/3 (0%)
Ig strand E 218..222 CDD:409353 1/3 (33%)
Ig strand F 232..237 CDD:409353 3/4 (75%)
Ig strand G 246..249 CDD:409353 0/2 (0%)
dpr11NP_788586.1 Ig 125..216 CDD:472250 48/92 (52%)
Ig strand B 135..139 CDD:409353 1/3 (33%)
Ig strand C 148..152 CDD:409353 2/3 (67%)
Ig strand E 183..187 CDD:409353 2/3 (67%)
Ig strand F 197..202 CDD:409353 3/4 (75%)
IG_like 227..320 CDD:214653 29/92 (32%)
Ig strand B 237..241 CDD:409544 2/3 (67%)
Ig strand C 252..256 CDD:409544 0/3 (0%)
Ig strand E 289..293 CDD:409544 1/3 (33%)
Ig strand G 313..316 CDD:409544 1/2 (50%)

Return to query results.
Submit another query.