DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr21 and LSAMP

DIOPT Version :9

Sequence 1:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001305844.1 Gene:LSAMP / 4045 HGNCID:6705 Length:361 Species:Homo sapiens


Alignment Length:229 Identity:55/229 - (24%)
Similarity:103/229 - (44%) Gaps:39/229 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 VPMKRV-LDRGPYFDTSATKNVTSLVGITGHLNCRIKNLGNKTVSWIRHRDLHLLTVSESTYTSD 104
            :|::.| .:||       |.|:|...|.|..|.|.:::..:| |:|:....  ::......::.|
Human    27 LPVRSVDFNRG-------TDNITVRQGDTAILRCVVEDKNSK-VAWLNRSG--IIFAGHDKWSLD 81

  Fly   105 QRFTSIYNKQTGDWSLQIKFPQLRDSGIYECQVSTTPPVGYTMVFSVVE---PITSILGGPEIYI 166
            .| ..:..:.:.::||:|:...:.|.|.|.|.|.|......:.|:.:|:   .|::|  ..::.:
Human    82 PR-VELEKRHSLEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNI--SSDVTV 143

  Fly   167 DLGSTVNLTCVIKHLPDPPISVQWNHNNQEINYDSPRGGVSVITEKGDITTSYLLIQRASIADSG 231
            :.||.|.|.|:....|:|.|:  |.|.       :|.|      .:.:....||.|...:...||
Human   144 NEGSNVTLVCMANGRPEPVIT--WRHL-------TPTG------REFEGEEEYLEILGITREQSG 193

  Fly   232 QYTCLPSN----ANSKSVNVHILKGDHPAAVQKS 261
            :|.|..:|    |:.|.|.|.:   ::|..:.:|
Human   194 KYECKAANEVSSADVKQVKVTV---NYPPTITES 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr21NP_001163838.2 Ig 71..149 CDD:299845 16/77 (21%)
IG_like 71..140 CDD:214653 15/68 (22%)
IG_like 162..249 CDD:214653 24/90 (27%)
IGc2 169..242 CDD:197706 21/76 (28%)
LSAMPNP_001305844.1 Ig 38..128 CDD:386229 22/93 (24%)
Ig 132..215 CDD:386229 26/99 (26%)
Ig_3 219..294 CDD:372822 1/6 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.