DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr21 and CG7166

DIOPT Version :10

Sequence 1:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_649339.2 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster


Alignment Length:241 Identity:60/241 - (24%)
Similarity:99/241 - (41%) Gaps:36/241 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 YLISENIVP--MKRVLDRGPYFDTSATKNVTSLVGITGHLNCRIKNLGNKTVSWIRHRDLHLLTV 96
            :::.||..|  ..:.|.||..:..        :||.|..|.|:::|||:..:.|  .:...:||.
  Fly    27 FILPENDPPTTAPKFLSRGHLYKV--------IVGETIELPCKVQNLGSFVLLW--RKGSSVLTA 81

  Fly    97 SESTYTSDQRFTSIYNKQTGDWSLQIKFPQLRDSGIYECQVSTTPPVGYTMVFSVVEPIT--SIL 159
            .....|.||||     |..||::|||...:.:|:|.|.||:.............::.|.|  ::.
  Fly    82 GHLKITRDQRF-----KIVGDYNLQINGVKTQDAGDYICQLGDQENRDQVHTVEILVPPTLRALP 141

  Fly   160 GGPEIYIDLGSTVNLTCVIKHLPDPPISVQWNHNNQEINYDSPRGGVSVITEKGDITTSYLLIQR 224
            ...::....||||.|.|.....|.|  ::.|...:.   :..|       |...|.:|  |:::.
  Fly   142 HNGQVTARKGSTVTLECKASGNPVP--TIFWFKKDV---FSGP-------THLSDSST--LILEN 192

  Fly   225 ASIADSGQYTCLPSNANSKSVNVHI---LKGDHPAAVQKSHLLVSE 267
            .....:|.|.|...|.....|::.|   :.......|:||.:..||
  Fly   193 VDRHHAGTYQCSADNGVKDRVSMDIQLTILSPPEITVEKSWVHASE 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr21NP_001163838.2 Ig 71..149 CDD:472250 24/77 (31%)
Ig strand C 82..86 CDD:409353 0/3 (0%)
Ig strand E 118..122 CDD:409353 1/3 (33%)
Ig strand F 132..137 CDD:409353 2/4 (50%)
Ig 169..249 CDD:472250 19/79 (24%)
Ig strand B 172..176 CDD:409353 2/3 (67%)
Ig strand C 187..191 CDD:409353 0/3 (0%)
Ig strand E 218..222 CDD:409353 1/3 (33%)
Ig strand F 232..237 CDD:409353 2/4 (50%)
Ig strand G 246..249 CDD:409353 0/2 (0%)
CG7166NP_649339.2 IG_like 50..133 CDD:214653 27/97 (28%)
Ig strand B 56..60 CDD:409353 1/3 (33%)
Ig strand C 69..73 CDD:409353 1/5 (20%)
Ig strand E 98..102 CDD:409353 1/3 (33%)
Ig strand F 112..116 CDD:409353 1/3 (33%)
Ig_3 134..207 CDD:464046 19/86 (22%)
Ig_3 224..301 CDD:464046 5/15 (33%)

Return to query results.
Submit another query.