DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr21 and CG7166

DIOPT Version :9

Sequence 1:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster


Alignment Length:241 Identity:60/241 - (24%)
Similarity:99/241 - (41%) Gaps:36/241 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 YLISENIVP--MKRVLDRGPYFDTSATKNVTSLVGITGHLNCRIKNLGNKTVSWIRHRDLHLLTV 96
            :::.||..|  ..:.|.||..:..        :||.|..|.|:::|||:..:.|  .:...:||.
  Fly    27 FILPENDPPTTAPKFLSRGHLYKV--------IVGETIELPCKVQNLGSFVLLW--RKGSSVLTA 81

  Fly    97 SESTYTSDQRFTSIYNKQTGDWSLQIKFPQLRDSGIYECQVSTTPPVGYTMVFSVVEPIT--SIL 159
            .....|.||||     |..||::|||...:.:|:|.|.||:.............::.|.|  ::.
  Fly    82 GHLKITRDQRF-----KIVGDYNLQINGVKTQDAGDYICQLGDQENRDQVHTVEILVPPTLRALP 141

  Fly   160 GGPEIYIDLGSTVNLTCVIKHLPDPPISVQWNHNNQEINYDSPRGGVSVITEKGDITTSYLLIQR 224
            ...::....||||.|.|.....|.|  ::.|...:.   :..|       |...|.:|  |:::.
  Fly   142 HNGQVTARKGSTVTLECKASGNPVP--TIFWFKKDV---FSGP-------THLSDSST--LILEN 192

  Fly   225 ASIADSGQYTCLPSNANSKSVNVHI---LKGDHPAAVQKSHLLVSE 267
            .....:|.|.|...|.....|::.|   :.......|:||.:..||
  Fly   193 VDRHHAGTYQCSADNGVKDRVSMDIQLTILSPPEITVEKSWVHASE 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr21NP_001163838.2 Ig 71..149 CDD:299845 24/77 (31%)
IG_like 71..140 CDD:214653 24/68 (35%)
IG_like 162..249 CDD:214653 19/86 (22%)
IGc2 169..242 CDD:197706 18/72 (25%)
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 27/97 (28%)
Ig 56..116 CDD:143165 22/66 (33%)
IG_like 144..221 CDD:214653 20/90 (22%)
IGc2 151..209 CDD:197706 18/71 (25%)
IG_like 232..313 CDD:214653 3/7 (43%)
Ig 242..311 CDD:143165
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.