DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr21 and dpr20

DIOPT Version :9

Sequence 1:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster


Alignment Length:236 Identity:91/236 - (38%)
Similarity:122/236 - (51%) Gaps:29/236 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 GPYFDT-----SATKNVTSLVGITGHLNCRIKNLGNKTVSWIRHRD----------LHLLTVSES 99
            ||:|:.     .|| |:|...|.:.||||||..|.:|||||:||..          |.||||...
  Fly   264 GPHFEDVQRIGQAT-NLTVQAGSSIHLNCRISLLQDKTVSWVRHNTQDEGKDNGNALDLLTVGMH 327

  Fly   100 TYTSDQRFTSIYNKQTGDWSLQIKFPQLRDSGIYECQVSTTPPVGYTMVFSVVEP---ITSILGG 161
            |||.|:|:...: :...:|.|:|...:..|..|||||:||.||....:...|..|   |...:|.
  Fly   328 TYTGDKRYKMEF-QYPNNWRLKITNVKKDDEAIYECQISTHPPRVIQINLHVNAPKVMIVDEVGD 391

  Fly   162 P--EIYIDLGSTVNLTCVIKHLPDPPISVQWNHNNQEINYDSPRGGVSVITE-KGDITTSYLLIQ 223
            |  |.|.::.||:.|:||::::......|.|.|.:..:|||..||||||.|| ..|...|.|.|.
  Fly   392 PLQEKYYEIDSTLQLSCVVRNVAMTSSVVFWKHMDNILNYDVTRGGVSVKTELMEDGANSTLSIA 456

  Fly   224 RASIADSGQYTCLPSNANSKSVNVHILKGD------HPAAV 258
            :.|..|||.|||..|...:.::.||||.|:      |..||
  Fly   457 KISKTDSGNYTCSISEFQNFTIVVHILNGESFAELHHGGAV 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr21NP_001163838.2 Ig 71..149 CDD:299845 36/87 (41%)
IG_like 71..140 CDD:214653 33/78 (42%)
IG_like 162..249 CDD:214653 35/89 (39%)
IGc2 169..242 CDD:197706 31/73 (42%)
dpr20NP_612066.1 IG_like 278..365 CDD:214653 36/87 (41%)
Ig 279..378 CDD:299845 39/99 (39%)
Ig 400..471 CDD:299845 30/70 (43%)
IG_like 402..480 CDD:214653 31/77 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444721
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.