DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr21 and wrapper

DIOPT Version :10

Sequence 1:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster


Alignment Length:231 Identity:52/231 - (22%)
Similarity:89/231 - (38%) Gaps:48/231 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 VGITGHLNCRIKNLGNKTVSWIRHRDLHLLTVSESTYTSDQRFTSIYNKQTGDWSLQIKFPQLRD 129
            :|....:.|..:.:....::|    .|:...:...:.|.        |:|    ||.::......
  Fly   146 IGAIFEVVCEAQGVPQPVITW----RLNGNVIQPQSNTG--------NRQ----SLILEIKSRNQ 194

  Fly   130 SGIYECQVST---TPPVGYTMVFSVVEPITSILGGPEIYIDLGSTVNLTCVIKHLPDPPISVQWN 191
            :|:.||..|.   .|.|....:..:..|..|| ..|.:|..|||..:|.|:::  ..|..:|:|.
  Fly   195 AGLIECVASNGVGEPAVANVYLHVLFSPEVSI-PQPVVYTKLGSRAHLECIVE--AAPAATVKWF 256

  Fly   192 HNNQEINYDSPRGGVSVITEKGDITTS------------YLLIQRASIADSGQYTCLPSNANS-K 243
            |:...:..     |....|.:.::.|:            .|:::....||.|||.|..||..| |
  Fly   257 HHGLPVAL-----GAHSTTHESELQTNRSVDHYVNAVRHMLVVKSVRNADMGQYECRASNQISVK 316

  Fly   244 SVNVHILKGDHPAAVQ--------KSHLLVSELLSL 271
            |.:|.:.....|...:        .||:||.:..||
  Fly   317 SGSVELTGRPMPCLFKINPGTQSSTSHVLVWQTESL 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr21NP_001163838.2 Ig 71..149 CDD:472250 14/80 (18%)
Ig strand C 82..86 CDD:409353 0/3 (0%)
Ig strand E 118..122 CDD:409353 2/3 (67%)
Ig strand F 132..137 CDD:409353 2/4 (50%)
Ig 169..249 CDD:472250 24/92 (26%)
Ig strand B 172..176 CDD:409353 1/3 (33%)
Ig strand C 187..191 CDD:409353 1/3 (33%)
Ig strand E 218..222 CDD:409353 1/15 (7%)
Ig strand F 232..237 CDD:409353 3/4 (75%)
Ig strand G 246..249 CDD:409353 1/2 (50%)
wrapperNP_477404.1 IG_like 41..118 CDD:214653
Ig strand B 52..56 CDD:409353
Ig strand C 64..68 CDD:409353
Ig strand E 94..98 CDD:409353
Ig strand F 108..113 CDD:409353
Ig strand G 122..125 CDD:409353
Ig 133..219 CDD:472250 15/88 (17%)
Ig strand B 150..154 CDD:409353 0/3 (0%)
Ig strand C 163..167 CDD:409353 1/7 (14%)
Ig strand E 183..187 CDD:409353 3/7 (43%)
Ig strand F 197..202 CDD:409353 2/4 (50%)
Ig strand G 211..214 CDD:409353 1/2 (50%)
Ig_3 222..311 CDD:464046 24/96 (25%)
FN3 339..431 CDD:238020 6/14 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.