DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr21 and Lac

DIOPT Version :10

Sequence 1:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster


Alignment Length:247 Identity:58/247 - (23%)
Similarity:90/247 - (36%) Gaps:47/247 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LCILILKETCPQHFRENVTVTDLYLISENIVPMKRVLDRGPYFDTSATKNVTSLVGITGHLNCRI 75
            |..:.:::|..|.     |.|..|:..|.|..                      :|.|...:|.:
  Fly    15 LLAIFVQQTLAQR-----TPTISYITQEQIKD----------------------IGGTVEFDCSV 52

  Fly    76 KNLGNKTVSWIR-HRDLHLLTVSESTYTSDQRFTSIYNKQTGDWSLQIKFPQLRDSGIYECQV-- 137
            :......|.::: ..|...|:...:....|.||:..|:..:..:.||||..|..|:|.|.|||  
  Fly    53 QYAKEYNVLFLKTDSDPVFLSTGSTLVIKDSRFSLRYDPNSSTYKLQIKDIQETDAGTYTCQVVI 117

  Fly   138 STTPPVGYTMVFSVVE-PITSILGGPEIYIDLGSTVNLTCVIKHLPDPPISVQWNHNNQEINYDS 201
            ||...|...:..||.. |:.|......:....||.|.:.|.....|.|.|:  |...|..|    
  Fly   118 STVHKVSAEVKLSVRRPPVISDNSTQSVVASEGSEVQMECYASGYPTPTIT--WRRENNAI---- 176

  Fly   202 PRGGVSVITEKGDITTSYLLIQRASIADSGQYTCLPSNANSK----SVNVHI 249
                  :.|:......:.|.|:.....|.|.|.|:..|..||    ::||.:
  Fly   177 ------LPTDSATYVGNTLRIKSVKKEDRGTYYCVADNGVSKGDRRNINVEV 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr21NP_001163838.2 Ig 71..149 CDD:472250 22/80 (28%)
Ig strand C 82..86 CDD:409353 1/3 (33%)
Ig strand E 118..122 CDD:409353 1/3 (33%)
Ig strand F 132..137 CDD:409353 2/4 (50%)
Ig 169..249 CDD:472250 22/83 (27%)
Ig strand B 172..176 CDD:409353 1/3 (33%)
Ig strand C 187..191 CDD:409353 0/3 (0%)
Ig strand E 218..222 CDD:409353 1/3 (33%)
Ig strand F 232..237 CDD:409353 2/4 (50%)
Ig strand G 246..249 CDD:409353 2/2 (100%)
LacNP_523713.2 IG_like 36..131 CDD:214653 26/116 (22%)
Ig strand B 46..50 CDD:409381 0/3 (0%)
Ig strand C 60..63 CDD:409381 1/2 (50%)
Ig strand E 96..100 CDD:409381 1/3 (33%)
Ig strand F 110..115 CDD:409381 2/4 (50%)
Ig strand G 124..127 CDD:409381 0/2 (0%)
Ig_3 134..208 CDD:464046 19/85 (22%)
Ig 227..318 CDD:472250
Ig strand C 256..260 CDD:409353
Ig strand E 286..290 CDD:409353
Ig strand F 300..305 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.