Sequence 1: | NP_001163838.2 | Gene: | dpr21 / 8674044 | FlyBaseID: | FBgn0260995 | Length: | 282 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006247755.1 | Gene: | Sdk2 / 360652 | RGDID: | 1310397 | Length: | 2175 | Species: | Rattus norvegicus |
Alignment Length: | 245 | Identity: | 64/245 - (26%) |
---|---|---|---|
Similarity: | 100/245 - (40%) | Gaps: | 57/245 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 24 FRENVTVT------------DLYLISENIVPMKR-----VLDRGPYFDTSATKNVTSLVGITGHL 71
Fly 72 NCRIKNLGNKTVSWIRHRDLHLLTVSESTYTSDQRFTSIYNKQTGDWSLQIKFPQLRDSGIYEC- 135
Fly 136 --------QVSTTPPVGYTMVFSVVEPITSILGGP--EIYIDLGSTVNLTCVIKHLPDPPISVQW 190
Fly 191 NHNNQEINYDSPRGGVSVITEKGDITTSYLLIQRASIADSGQYTCLPSNA 240 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr21 | NP_001163838.2 | Ig | 71..149 | CDD:299845 | 23/86 (27%) |
IG_like | 71..140 | CDD:214653 | 21/77 (27%) | ||
IG_like | 162..249 | CDD:214653 | 25/81 (31%) | ||
IGc2 | 169..242 | CDD:197706 | 22/72 (31%) | ||
Sdk2 | XP_006247755.1 | IG_like | 43..112 | CDD:214653 | |
IGc2 | 43..101 | CDD:197706 | |||
IG_like | 123..206 | CDD:214653 | |||
Ig | 135..191 | CDD:299845 | |||
IG_like | 225..307 | CDD:214653 | 6/38 (16%) | ||
IGc2 | 236..289 | CDD:197706 | 2/20 (10%) | ||
I-set | 311..400 | CDD:254352 | 26/105 (25%) | ||
Ig | 329..397 | CDD:143165 | 22/84 (26%) | ||
I-set | 405..495 | CDD:254352 | 28/90 (31%) | ||
Ig | 419..495 | CDD:299845 | 22/72 (31%) | ||
Ig | 505..589 | CDD:299845 | |||
IG_like | 505..589 | CDD:214653 | |||
FN3 | 593..684 | CDD:238020 | |||
FN3 | 696..789 | CDD:238020 | |||
FN3 | 797..893 | CDD:238020 | |||
FN3 | 898..986 | CDD:238020 | |||
FN3 | 996..1090 | CDD:238020 | |||
FN3 | 1102..1197 | CDD:238020 | |||
FN3 | 1204..1293 | CDD:238020 | |||
FN3 | 1304..1397 | CDD:238020 | |||
FN3 | 1403..1487 | CDD:238020 | |||
FN3 | 1506..1619 | CDD:238020 | |||
FN3 | 1629..1722 | CDD:238020 | |||
FN3 | 1727..1808 | CDD:238020 | |||
FN3 | 1840..1919 | CDD:238020 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |