DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr21 and DIP-eta

DIOPT Version :9

Sequence 1:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001188701.2 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster


Alignment Length:251 Identity:72/251 - (28%)
Similarity:109/251 - (43%) Gaps:45/251 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IFLCILILKETCPQHFRENVTVTDLYLISENIVPMKRVLDRGPYFDTSATKNVTSLVGITGHLNC 73
            |.|.||:.::..||...               ||.:.::|  |.| :|...|:|:.||....|.|
  Fly    18 ILLLILMSQQCYPQRVE---------------VPAEVIVD--PKF-SSPIVNMTAPVGRDAFLTC 64

  Fly    74 RIKNLGNKTVSWIRHRDLHLLTVSESTYTSDQRFTSIYNKQTGDWSLQIKFPQLRDSGIYECQVS 138
            .:::||...|:|:|.....:||:.....|.:||. .|.|.:...|:::||..:..|.|.|.||::
  Fly    65 VVQDLGPYKVAWLRVDTQTILTIQNHVITKNQRI-GIANSEHKTWTMRIKDIKESDKGWYMCQIN 128

  Fly   139 TTP---PVGYTMVFSVVEPITSILGGP---EIYIDLGSTVNLTCVIKHLPDPPISVQWNHNNQEI 197
            |.|   .:||..|  ||.|  .||..|   ::.:..||.|.|.|.....|:|.|:  |...:   
  Fly   129 TDPMKSQMGYLDV--VVPP--DILDYPTSTDMVVREGSNVTLKCAATGSPEPTIT--WRRES--- 184

  Fly   198 NYDSPRGGVSVITEKGD----ITTSYLLIQRASIADSGQYTCLPSNANSKSVNVHI 249
                   ||.:....|:    |..:.|:|........|.|.|:.||....||:..|
  Fly   185 -------GVPIELATGEEVMSIEGTDLVIPNVRRHHMGAYLCIASNGVPPSVSKRI 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr21NP_001163838.2 Ig 71..149 CDD:299845 26/80 (33%)
IG_like 71..140 CDD:214653 22/68 (32%)
IG_like 162..249 CDD:214653 23/93 (25%)
IGc2 169..242 CDD:197706 20/76 (26%)
DIP-etaNP_001188701.2 Ig 51..141 CDD:299845 30/90 (33%)
IG_like 51..137 CDD:214653 28/86 (33%)
IG_like 153..237 CDD:214653 23/93 (25%)
Ig 161..224 CDD:299845 19/74 (26%)
IG_like 252..335 CDD:214653
Ig 258..333 CDD:143165
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.