DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr21 and bdl

DIOPT Version :9

Sequence 1:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster


Alignment Length:282 Identity:64/282 - (22%)
Similarity:102/282 - (36%) Gaps:66/282 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TFRIFLCILILKETCPQHFRENVTVTDLYLISENIVPMKRVLDRG--------PYFDTSATKNVT 62
            |..:|...|.|.|..|:..|.:|.:|.:           |..|:|        |....|...|.|
  Fly    88 TSELFNGRLHLVENHPEFGRASVNLTAI-----------RESDQGWYHCQVSFPNRSPSVRNNGT 141

  Fly    63 ---------SLV-----------GITGHLNCRIKNLGNKTVSWIRHRDLHLLTVSESTYTSDQRF 107
                     ||:           |.|...:|.:|:..|...||  ::|..||   :......:||
  Fly   142 AYHLAVQGGSLIRIPPVNQTIREGQTAFFHCVMKHPENSQASW--YKDGVLL---QEVQDLVRRF 201

  Fly   108 TSIYNKQTGDWSLQIKFPQLRDSGIYECQVSTTPPVGYT--MVFSVVEPITSILGGPEIYIDLGS 170
                 ....|.||.|....:.|.|.|||:|..:.....|  ...::......|...||:::..|.
  Fly   202 -----YMGPDGSLSIDPTMMSDLGEYECKVRNSDGELQTAKAFLNIQYKAKVIYAPPEVFLPYGQ 261

  Fly   171 TVNLTCVIKHLPDPPI-SVQWNHNNQEINYDSPRGGVSVITEKGDITTSYLLIQRASIADSGQYT 234
            ...|.|..:  .:||: :::|..:.  :.:||  ..|..:..|   ....|...:.....:|.||
  Fly   262 PAVLDCHFR--ANPPLKNLRWEKDG--LLFDS--YNVPGVFYK---MNGSLFFAKVDENHAGSYT 317

  Fly   235 CLPSN-----ANSKSVNVHILK 251
            |.|.|     ..|..::|.:|:
  Fly   318 CTPYNDLGTDGPSPVISVIVLR 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr21NP_001163838.2 Ig 71..149 CDD:299845 21/79 (27%)
IG_like 71..140 CDD:214653 20/68 (29%)
IG_like 162..249 CDD:214653 21/92 (23%)
IGc2 169..242 CDD:197706 17/78 (22%)
bdlNP_608822.1 IG_like 42..128 CDD:214653 12/50 (24%)
Ig 43..131 CDD:299845 12/53 (23%)
I-set 153..242 CDD:254352 23/98 (23%)
Ig 157..242 CDD:299845 23/94 (24%)
Ig_2 252..337 CDD:290606 21/93 (23%)
IG_like 260..327 CDD:214653 17/75 (23%)
I-set 341..428 CDD:254352
IGc2 356..419 CDD:197706
FN3 435..524 CDD:238020
FN3 554..636 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.