DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr21 and dpr2

DIOPT Version :9

Sequence 1:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster


Alignment Length:243 Identity:95/243 - (39%)
Similarity:135/243 - (55%) Gaps:43/243 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 PYFDTSATKNVTSLVGITGHLNCRIKNLGNKTVSWIRHRDLHLLTVSESTYTSDQRFTSIYNKQT 115
            |.||....:|:|:..|.|..:|||:.|||:|:|||||.||||:||....|||||:||..:....:
  Fly   106 PVFDFGMPRNITTRTGHTAAINCRVDNLGDKSVSWIRKRDLHILTAGILTYTSDERFKVVRTADS 170

  Fly   116 GDWSLQIKFPQLRDSGIYECQVSTTPPVGYTMVFS---VVEP--ITSILGGP-EIYIDLGSTVNL 174
            .||:|.:|:.|.||||||||||:|.|.:  :|.|.   :|.|  ..:|:.|| ::|:.:||:|.|
  Fly   171 KDWTLHVKYAQPRDSGIYECQVNTEPKI--SMAFRLNVIVTPPDAKAIIAGPTDLYVKVGSSVTL 233

  Fly   175 TCVIKHLPDPPISVQ------W-----------NHNN------QEINYDSPRGGVSVITEKGDIT 216
            ||   |:..|..|.|      |           .|.|      |.|:.:      |.:.||   .
  Fly   234 TC---HVKQPATSAQDIGPIYWYRGPYILTPFVAHPNDAAIDLQRISME------STLAEK---L 286

  Fly   217 TSYLLIQRASIADSGQYTCLPSNANSKSVNVHILKGDHPAAVQKSHLL 264
            .|.|.|..|.:.|:|.|||:|:.|.:.||.|:::..:.|||:|||..:
  Fly   287 QSRLRIANAQLLDTGNYTCMPTTAEAASVVVNVINDESPAAMQKSRAI 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr21NP_001163838.2 Ig 71..149 CDD:299845 43/77 (56%)
IG_like 71..140 CDD:214653 40/68 (59%)
IG_like 162..249 CDD:214653 34/110 (31%)
IGc2 169..242 CDD:197706 29/95 (31%)
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 48/94 (51%)
Ig 116..192 CDD:299845 41/75 (55%)
ig 220..306 CDD:278476 28/97 (29%)
IG_like 220..306 CDD:214653 28/97 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444731
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
76.990

Return to query results.
Submit another query.