DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr21 and dpr4

DIOPT Version :9

Sequence 1:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster


Alignment Length:232 Identity:109/232 - (46%)
Similarity:152/232 - (65%) Gaps:2/232 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 PYFDTSATKNVTSLVGITGHLNCRIKNLGNKTVSWIRHRDLHLLTVSESTYTSDQRFTSIYNKQT 115
            ||||.|:.:.||:.||....|:||::|||::.|||||.||||:|||...|||:||||.|::::.:
  Fly    45 PYFDNSSRREVTATVGQAALLHCRVRNLGDRAVSWIRKRDLHILTVGILTYTNDQRFQSLHSEGS 109

  Fly   116 GDWSLQIKFPQLRDSGIYECQVSTTPPVGYTMVFSVVEPITSILGGPEIYIDLGSTVNLTCVIKH 180
            .:|:|:|..||.||||.|||||||.|.:......:||.....|||..|::|..||.:||||:...
  Fly   110 DEWTLRISSPQPRDSGTYECQVSTEPKISQGFRLNVVVSRAKILGNAELFIKSGSDINLTCLAMQ 174

  Fly   181 LPDPPISVQWNHNNQEINYDSPRGGVSVITEKGDITTSYLLIQRASIADSGQYTCLPSNANSKSV 245
            .|.||..:.|....:.:|| |.|||::||||: ...||.|||.:|:.||||.|||.||:::|.||
  Fly   175 SPVPPSFIYWYKGKRVMNY-SQRGGINVITER-STRTSKLLIAKATPADSGNYTCSPSSSDSASV 237

  Fly   246 NVHILKGDHPAAVQKSHLLVSELLSLCFLQICLNLST 282
            .||::.|:||||:|..:...:.|..|....:...|:|
  Fly   238 VVHVINGEHPAAMQHGNSSATCLRPLSSTSVPFVLAT 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr21NP_001163838.2 Ig 71..149 CDD:299845 43/77 (56%)
IG_like 71..140 CDD:214653 41/68 (60%)
IG_like 162..249 CDD:214653 41/86 (48%)
IGc2 169..242 CDD:197706 35/72 (49%)
dpr4NP_001014616.2 V-set 53..146 CDD:284989 47/92 (51%)
IG_like 53..145 CDD:214653 47/91 (52%)
ig 153..227 CDD:278476 35/75 (47%)
IG_like 161..>227 CDD:214653 31/67 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444743
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
76.990

Return to query results.
Submit another query.