DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr21 and DIP-beta

DIOPT Version :10

Sequence 1:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster


Alignment Length:233 Identity:59/233 - (25%)
Similarity:97/233 - (41%) Gaps:32/233 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 KNVTSLVGITGHLNCRIKNLGNKTVS-----------WIRHRDLHLLTVSESTYTSDQRFTSIYN 112
            :|||...|......|.:.|||...||           ||:.....:|.:.|...|::.|. |:.:
  Fly   105 ENVTIAQGRDATFTCVVNNLGGHRVSGDGSSAPAKVAWIKADAKAILAIHEHVITNNDRL-SVQH 168

  Fly   113 KQTGDWSLQIKFPQLRDSGIYECQVSTTPPVGYTMVFSVVEP---ITSILGGPEIYIDLGSTVNL 174
            .....|:|.|:..::.|:|.|.|||:|.|....|....||.|   |.....| ::.:..|.:..|
  Fly   169 NDYNTWTLNIRGVKMEDAGKYMCQVNTDPMKMQTATLEVVIPPDIINEETSG-DMMVPEGGSAKL 232

  Fly   175 TCVIKHLPDPPISVQW-NHNNQEINYDSPRGGVSVITEKGDITTSYLLIQRASIADSGQYTCLPS 238
            .|..:..|.|.|:  | ..:.:||   ..|.|....|:...:....|.:.:.:.::.|.|.|:.|
  Fly   233 VCRARGHPKPKIT--WRREDGREI---IARNGSHQKTKAQSVEGEMLTLSKITRSEMGAYMCIAS 292

  Fly   239 NANSKSVN------VHILKGDHPAAVQKSHLLVSELLS 270
            |....:|:      ||.    ||.....:.|:.:.:|:
  Fly   293 NGVPPTVSKRMKLQVHF----HPLVQVPNQLVGAPVLT 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr21NP_001163838.2 Ig 71..149 CDD:472250 25/88 (28%)
Ig strand C 82..86 CDD:409353 2/14 (14%)
Ig strand E 118..122 CDD:409353 2/3 (67%)
Ig strand F 132..137 CDD:409353 2/4 (50%)
Ig 169..249 CDD:472250 20/86 (23%)
Ig strand B 172..176 CDD:409353 1/3 (33%)
Ig strand C 187..191 CDD:409353 1/4 (25%)
Ig strand E 218..222 CDD:409353 1/3 (33%)
Ig strand F 232..237 CDD:409353 2/4 (50%)
Ig strand G 246..249 CDD:409353 1/8 (13%)
DIP-betaNP_001138225.1 Ig 98..209 CDD:472250 30/104 (29%)
Ig strand B 115..119 CDD:409353 0/3 (0%)
Ig strand C 139..143 CDD:409353 0/3 (0%)
Ig strand E 174..178 CDD:409353 2/3 (67%)
Ig strand F 188..193 CDD:409353 2/4 (50%)
Ig strand G 202..205 CDD:409353 1/2 (50%)
Ig 211..307 CDD:472250 21/101 (21%)
Ig strand B 230..234 CDD:409353 1/3 (33%)
Ig strand C 243..247 CDD:409353 1/5 (20%)
Ig strand E 272..276 CDD:409353 1/3 (33%)
Ig strand F 286..291 CDD:409353 2/4 (50%)
Ig strand G 300..303 CDD:409353 0/2 (0%)
IG_like 327..405 CDD:214653 59/233 (25%)
Ig strand B 328..332 CDD:409353
Ig strand C 341..346 CDD:409353
Ig strand E 365..376 CDD:409353
Ig strand F 386..391 CDD:409353
Ig strand G 399..402 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.