Sequence 1: | NP_001163838.2 | Gene: | dpr21 / 8674044 | FlyBaseID: | FBgn0260995 | Length: | 282 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_808547.3 | Gene: | Sdk1 / 330222 | MGIID: | 2444413 | Length: | 2193 | Species: | Mus musculus |
Alignment Length: | 240 | Identity: | 58/240 - (24%) |
---|---|---|---|
Similarity: | 92/240 - (38%) | Gaps: | 35/240 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 31 TDLYLISENIVPMKRVLDRGPYFDTSATKNVTSLVGITGHLNCRIKNLGNKTVSWIRHRDLHLLT 95
Fly 96 VSESTYTSDQRFTSIYNKQTGDWSLQIKFPQLRDSGIYECQVSTTPPVGYTMVFSVVEPITSILG 160
Fly 161 GPEIYIDL-GSTVNLTCVIKHLPDPPISVQWNHNNQEINYDSPRGGVSVITEKGDITTSYLLIQR 224
Fly 225 ASIADSGQYTC---LPSNANSKSVNVHILKGDHPAAVQKSHLLVS 266 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr21 | NP_001163838.2 | Ig | 71..149 | CDD:299845 | 15/77 (19%) |
IG_like | 71..140 | CDD:214653 | 14/68 (21%) | ||
IG_like | 162..249 | CDD:214653 | 22/90 (24%) | ||
IGc2 | 169..242 | CDD:197706 | 19/75 (25%) | ||
Sdk1 | NP_808547.3 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..56 | ||
Ig_2 | 94..169 | CDD:290606 | |||
IG_like | 100..169 | CDD:214653 | |||
IG_like | 183..263 | CDD:214653 | |||
Ig | 197..247 | CDD:299845 | |||
IG_like | 281..357 | CDD:214653 | |||
IGc2 | 294..347 | CDD:197706 | |||
I-set | 368..457 | CDD:254352 | 3/5 (60%) | ||
Ig | 388..454 | CDD:143165 | 1/2 (50%) | ||
I-set | 462..552 | CDD:254352 | 22/109 (20%) | ||
Ig | 476..552 | CDD:299845 | 17/85 (20%) | ||
I-set | 557..646 | CDD:254352 | 24/95 (25%) | ||
Ig | 562..646 | CDD:299845 | 22/90 (24%) | ||
FN3 | 650..741 | CDD:238020 | 5/14 (36%) | ||
fn3 | 753..839 | CDD:278470 | |||
FN3 | 854..949 | CDD:238020 | |||
FN3 | 954..1036 | CDD:238020 | |||
FN3 | 1052..1148 | CDD:238020 | |||
FN3 | 1158..1253 | CDD:238020 | |||
FN3 | 1261..1349 | CDD:238020 | |||
FN3 | 1360..1453 | CDD:238020 | |||
FN3 | 1459..1554 | CDD:238020 | |||
FN3 | 1562..1676 | CDD:238020 | |||
FN3 | 1686..1779 | CDD:238020 | |||
FN3 | 1784..1865 | CDD:238020 | |||
FN3 | 1885..1978 | CDD:238020 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 2057..2080 | ||||
PDZ-binding. /evidence=ECO:0000250|UniProtKB:Q6V4S5 | 2187..2193 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |