DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr21 and LOC3290147

DIOPT Version :10

Sequence 1:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster
Sequence 2:XP_061500912.1 Gene:LOC3290147 / 3290147 VectorBaseID:AGAMI1_007173 Length:325 Species:Anopheles gambiae


Alignment Length:52 Identity:10/52 - (19%)
Similarity:21/52 - (40%) Gaps:3/52 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 SEDDREASDWQLQFHLGWFAHPIFSAEGDYPSIMKERIGNLSEAQGFPQSRL 315
            ||::.::....:..:...|..|.......:|...||   :|.:..|..:.|:
Mosquito   201 SEEEEDSDKGPITINTNNFQCPECEFHAKFPKPYKE---HLQKEHGLQRPRI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr21NP_001163838.2 Ig 71..149 CDD:472250
Ig strand C 82..86 CDD:409353
Ig strand E 118..122 CDD:409353
Ig strand F 132..137 CDD:409353
Ig 169..249 CDD:472250
Ig strand B 172..176 CDD:409353
Ig strand C 187..191 CDD:409353
Ig strand E 218..222 CDD:409353
Ig strand F 232..237 CDD:409353
Ig strand G 246..249 CDD:409353
LOC3290147XP_061500912.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.