Sequence 1: | NP_001163838.2 | Gene: | dpr21 / 8674044 | FlyBaseID: | FBgn0260995 | Length: | 282 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_723828.1 | Gene: | DIP-kappa / 318958 | FlyBaseID: | FBgn0051814 | Length: | 672 | Species: | Drosophila melanogaster |
Alignment Length: | 196 | Identity: | 57/196 - (29%) |
---|---|---|---|
Similarity: | 87/196 - (44%) | Gaps: | 18/196 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 60 NVTSLVGITGHLNCRIKNLGNKTVSWIRHRDLHLLTVSESTYTSDQRFTSIYNKQTGDWSLQIKF 124
Fly 125 PQLRDSGIYECQVSTTP---PVGYTMVFSVVEP-ITSILGGPEIYIDLGSTVNLTCVIKHLPDPP 185
Fly 186 ISVQWNHNNQEINYDSPRGGVSVITEKGDITTSYLLIQRASIADSGQYTCLPSNANSKSVN--VH 248
Fly 249 I 249 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr21 | NP_001163838.2 | Ig | 71..149 | CDD:299845 | 24/80 (30%) |
IG_like | 71..140 | CDD:214653 | 20/68 (29%) | ||
IG_like | 162..249 | CDD:214653 | 21/88 (24%) | ||
IGc2 | 169..242 | CDD:197706 | 19/72 (26%) | ||
DIP-kappa | NP_723828.1 | Ig | 80..172 | CDD:299845 | 29/90 (32%) |
IG_like | 82..174 | CDD:214653 | 30/94 (32%) | ||
IG_like | 184..267 | CDD:214653 | 22/91 (24%) | ||
IGc2 | 191..255 | CDD:197706 | 19/72 (26%) | ||
IG_like | 282..368 | CDD:214653 | |||
Ig | 288..367 | CDD:143165 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 46 | 1.000 | Domainoid score | I11916 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |