DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr21 and DIP-alpha

DIOPT Version :9

Sequence 1:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001259218.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster


Alignment Length:225 Identity:57/225 - (25%)
Similarity:100/225 - (44%) Gaps:23/225 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 PYFDTSATKNVTSLVGITGHLNCRIKNLGNKTVSWIRHRDLHLLTVSESTYTSDQRFTSIYNKQT 115
            |.| ..:..||:..||......|.:::||...|.|::.....:..:.|:..|.:.|.| :.:...
  Fly    42 PEF-VESISNVSVAVGRDATFTCHVRHLGGYRVGWLKADTKAIQAIHENVITHNPRVT-VSHLDQ 104

  Fly   116 GDWSLQIKFPQLRDSGIYECQVSTTP---PVGYTMVFSVVEP-ITSILGGPEIYIDLGSTVNLTC 176
            ..|:|.||.....|.|.|.||::|.|   .:|:..|  |:.| ..|.....::.:..||:|.|||
  Fly   105 NTWNLHIKAVSEEDRGGYMCQLNTDPMKSQIGFLDV--VIPPDFISEDTSSDVIVPEGSSVRLTC 167

  Fly   177 VIKHLPDPPISVQWNHNNQEINYDSPRGGVSVITEKGDITTSYLLIQRASIADSGQYTCLPSNAN 241
            ..:..|:|.::.:....|:.:..|:........:.:|::    |.:.:.|..:.|.|.|:.||..
  Fly   168 RARGYPEPIVTWRREDGNEIVLKDNVGTKTLAPSFRGEV----LKLSKISRNEMGSYLCIASNGV 228

  Fly   242 SKSV------NVHILKGDHPAAVQKSHLLV 265
            ..||      ::|.    || .:|..:.||
  Fly   229 PPSVSKRISLSIHF----HP-VIQVPNQLV 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr21NP_001163838.2 Ig 71..149 CDD:299845 21/80 (26%)
IG_like 71..140 CDD:214653 18/68 (26%)
IG_like 162..249 CDD:214653 20/92 (22%)
IGc2 169..242 CDD:197706 18/72 (25%)
DIP-alphaNP_001259218.1 IG_like 49..129 CDD:214653 22/80 (28%)
Ig 51..131 CDD:299845 22/80 (28%)
I-set 144..240 CDD:254352 22/99 (22%)
IGc2 159..228 CDD:197706 18/72 (25%)
Ig 244..337 CDD:299845 4/11 (36%)
I-set 244..337 CDD:254352 4/11 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.