DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr21 and rst

DIOPT Version :9

Sequence 1:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001284835.1 Gene:rst / 31290 FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster


Alignment Length:227 Identity:55/227 - (24%)
Similarity:81/227 - (35%) Gaps:72/227 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LISENIVPMKRVLDRGPYFDTS--------ATKNVTSLVGITGHLNCRIKNLGNKTVSWIR---- 87
            |:...||.|.|   ..||  ||        ..::.|::||....|.||:.| ...|:.|.:    
  Fly     8 LLLATIVGMVR---SSPY--TSYQNQRFAMEPQDQTAVVGARVTLPCRVIN-KQGTLQWTKDDFG 66

  Fly    88 ---HRDLHLLTVSESTYTSDQRFTSIYNKQTGDWSLQIKFPQLRDSGIYECQVSTTPP------- 142
               .|||          :..:|:..:.:.:.||:||.|....|.|...|:||||..|.       
  Fly    67 LGTSRDL----------SGFERYAMVGSDEEGDYSLDIYPVMLDDDARYQCQVSPGPEGQPAIRS 121

  Fly   143 --VGYTMVFSVVEPITSILGGPEIYIDLGSTVNLTCVIKHLPDPPISVQWNHNNQEINYDSPRGG 205
              .|.|::.....|  .|..|..||......|.:.||         ||.          ..|...
  Fly   122 TFAGLTVLVPPEAP--KITQGDVIYATEDRKVEIECV---------SVG----------GKPAAE 165

  Fly   206 VSVITEKGDITTSYLLIQRASIADSGQYTCLP 237
            ::.|...|::.|           |:.:||.:|
  Fly   166 ITWIDGLGNVLT-----------DNIEYTVIP 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr21NP_001163838.2 Ig 71..149 CDD:299845 25/93 (27%)
IG_like 71..140 CDD:214653 22/75 (29%)
IG_like 162..249 CDD:214653 15/76 (20%)
IGc2 169..242 CDD:197706 13/69 (19%)
rstNP_001284835.1 IG_like 34..130 CDD:214653 28/106 (26%)
Ig 42..114 CDD:299845 23/82 (28%)
C2-set_2 135..225 CDD:285423 18/84 (21%)
Ig_3 265..329 CDD:290638
I-set 346..420 CDD:254352
Ig 360..425 CDD:299845
Ig5_KIRREL3-like 428..524 CDD:143235
IG_like 435..524 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.