DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr21 and dpr7

DIOPT Version :9

Sequence 1:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster


Alignment Length:273 Identity:105/273 - (38%)
Similarity:159/273 - (58%) Gaps:33/273 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 YLISENIVPMKRVLDRGPYFDTSATKNVTSLVGITGHLNCRIKNLGNKTVSWIRHRDLHLLTVSE 98
            ||...::..::|     |:||..:.:||:::|.....|.||:||.||:||||:|.||||:||.:.
  Fly    39 YLSLNDLTNLER-----PFFDDISPRNVSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNI 98

  Fly    99 STYTSDQRFTSIYNKQTGDWSLQIKFPQLRDSGIYECQVSTTPPVGYTMVFSVV----------- 152
            .|||.||||:.|:...:.||.|:|.:.|.||||:|||||:|.|.:...:...|:           
  Fly    99 YTYTGDQRFSVIHPPGSEDWDLKIDYAQPRDSGVYECQVNTEPKINLAICLQVIADNDFQDLKTK 163

  Fly   153 -------EPITSILGGPEIYIDLGSTVNLTCVIK-HLPDPPISVQWNHNNQEINYDSPRGGVSVI 209
                   .....|||..||::...||:.|.|.:. |.|    ||.|.|.:..:::||.|||:|:.
  Fly   164 KRFYDTKSARAKILGSTEIHVKRDSTIALACSVNIHAP----SVIWYHGSSVVDFDSLRGGISLE 224

  Fly   210 TEKGDI-TTSYLLIQRASIADSGQYTCLPSNANSKSVNVHILKGDHPAAVQKSHLL----VSELL 269
            |||.|: |||.|::.|||:.|||.|||:|:.|...||.||:|.|:.|||:|.|..:    .:.::
  Fly   225 TEKTDVGTTSRLMLTRASLRDSGNYTCVPNGAIPASVRVHVLTGEQPAAMQTSSAIRIRAFTAMI 289

  Fly   270 SLCFLQICLNLST 282
            ::...::.|.:|:
  Fly   290 TIISTKVLLYISS 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr21NP_001163838.2 Ig 71..149 CDD:299845 42/77 (55%)
IG_like 71..140 CDD:214653 40/68 (59%)
IG_like 162..249 CDD:214653 40/88 (45%)
IGc2 169..242 CDD:197706 35/74 (47%)
dpr7NP_001096850.2 V-set 56..145 CDD:284989 45/88 (51%)
IG_like 58..140 CDD:214653 43/81 (53%)
IG_like 179..265 CDD:214653 40/89 (45%)
Ig 187..257 CDD:299845 34/73 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
66.060

Return to query results.
Submit another query.