DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr21 and dpr1

DIOPT Version :9

Sequence 1:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster


Alignment Length:242 Identity:102/242 - (42%)
Similarity:142/242 - (58%) Gaps:17/242 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 PYFDTSATKNVTSLVGITGHLNCRIKNLGNKTVSWIRHRDLHLLTVSESTYTSDQRFTSIYNKQT 115
            ||||....:|:|..||.||.|:||::.||:|.|||||.||||:||...:||||||||..:....:
  Fly    53 PYFDFDVPRNLTVTVGQTGFLHCRVERLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVLRPDGS 117

  Fly   116 GDWSLQIKFPQLRDSGIYECQVSTTPPVGYTMVFSVVEPITSILGGPEIYIDLGSTVNLTCVIKH 180
            .:|:||||:||.||||:||||::|.|.:..:..|:|||....|.|..::.:..||.:||||.|..
  Fly   118 ANWTLQIKYPQPRDSGVYECQINTEPKMSLSYTFNVVELKAEIFGPSDLMVKTGSDINLTCKIMQ 182

  Fly   181 LPDPPISVQWNHNNQ------EINYDSPRGGVSVITEKGDITTSYLLIQRASIADSGQYTCLPSN 239
            .|....::.|...::      |...||....:.|..:..|..||.|.|:||...|:|.|||:|:.
  Fly   183 GPHELGNIFWYKGSEMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCVPTV 247

  Fly   240 ANSKSVNVHILKGDHPAAVQKSHLLVSE---------LLSL--CFLQ 275
            |.:.||.||::.|:||||:|.:....|.         |||:  |.||
  Fly   248 AKTSSVYVHVIIGEHPAAMQHNSSSNSNSFYCGICCMLLSIVSCCLQ 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr21NP_001163838.2 Ig 71..149 CDD:299845 42/77 (55%)
IG_like 71..140 CDD:214653 40/68 (59%)
IG_like 162..249 CDD:214653 30/92 (33%)
IGc2 169..242 CDD:197706 27/78 (35%)
dpr1NP_001286645.1 Ig 59..154 CDD:299845 49/94 (52%)
IG_like 60..150 CDD:214653 48/89 (54%)
IG_like 163..257 CDD:214653 30/93 (32%)
Ig 174..244 CDD:143165 22/69 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
66.060

Return to query results.
Submit another query.