DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr21 and dpr9

DIOPT Version :9

Sequence 1:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001287332.1 Gene:dpr9 / 2768670 FlyBaseID:FBgn0038282 Length:602 Species:Drosophila melanogaster


Alignment Length:263 Identity:143/263 - (54%)
Similarity:185/263 - (70%) Gaps:22/263 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 NIVPMKRVLDRGPYFDTSATKNVTSLVGITGHLNCRIKNLGNKT----VSWIRHRDLHLLTVSES 99
            |.:.::...:.|||||.:.:||||:|:|.|.:||||:|||||||    |||:||||:|||||...
  Fly   244 NSIDLEEARNAGPYFDKAFSKNVTALLGKTAYLNCRVKNLGNKTMLLQVSWVRHRDIHLLTVGRY 308

  Fly   100 TYTSDQRFTSIYNKQTGDWSLQIKFPQLRDSGIYECQVSTTPPVGYTMVFSVVEPITSILGGPEI 164
            ||||||||.:|:..||.||.||||:||.||||||||||||||.:.:.:..:||||.|.|:|.|::
  Fly   309 TYTSDQRFRAIHQPQTEDWMLQIKYPQHRDSGIYECQVSTTPHMSHYIHLNVVEPSTEIIGAPDL 373

  Fly   165 YIDLGSTVNLTCVIKHLPDPPISVQWNHNN------QEINYDSPRGGVSVITEKGDITTSYLLIQ 223
            ||:.|||:||||:|::.|:||..:.|||||      |.||||||||||||:|.|||.|||:|||:
  Fly   374 YIESGSTINLTCIIQNSPEPPAYIFWNHNNAFPSHPQIINYDSPRGGVSVVTNKGDTTTSFLLIK 438

  Fly   224 RASIADSGQYTCLPSNANSKSVNVHILKG-DHPAA--VQKSHLL--------VSELLSLCFLQIC 277
            .|..:|||.|.|.||||..|||.||:|.| .|..:  |..|:..        ::..||:| :.:|
  Fly   439 SARPSDSGHYQCNPSNAKPKSVTVHVLNGVSHSVSRGVPSSNAARGTSASSPLAHSLSVC-VPVC 502

  Fly   278 LNL 280
            :.|
  Fly   503 VLL 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr21NP_001163838.2 Ig 71..149 CDD:299845 56/81 (69%)
IG_like 71..140 CDD:214653 53/72 (74%)
IG_like 162..249 CDD:214653 56/92 (61%)
IGc2 169..242 CDD:197706 49/78 (63%)
dpr9NP_001287332.1 Ig 263..361 CDD:299845 63/97 (65%)
IG_like 263..360 CDD:214653 63/96 (66%)
IG_like 371..464 CDD:214653 56/92 (61%)
IGc2 377..456 CDD:197706 48/78 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446145
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I5030
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D77526at33392
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
88.000

Return to query results.
Submit another query.