DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr21 and Jaml

DIOPT Version :9

Sequence 1:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster
Sequence 2:XP_006510445.4 Gene:Jaml / 270152 MGIID:2685484 Length:405 Species:Mus musculus


Alignment Length:224 Identity:46/224 - (20%)
Similarity:92/224 - (41%) Gaps:38/224 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 VGITGHLNCRIKNLGNK---TVSWIRHRD---------LHLLTVSESTYTSDQRFTSIYNKQTGD 117
            ||.:..:.|.::....|   .|.|:..:|         .:...:|..|.....|...:.:....|
Mouse    63 VGESVLMGCVVQRTEEKHVDRVDWLFSKDKDDASEYVLFYYSNLSVPTGRFQNRSHLVGDTFHND 127

  Fly   118 WSLQIKFPQLRDSGIYECQVSTTPPVGYTMVFSVVEPITSILGGP-EIYIDLGSTVNLTCVIKHL 181
            .||.::..|..|.|||.|::...   ..:||......:..:...| ::.:.:|.|..:.|.|:..
Mouse   128 GSLLLQDVQKADEGIYTCEIRLK---NESMVMKKPVELWVLPEEPKDLRVRVGDTTQMRCSIQST 189

  Fly   182 PDPPIS-VQW-----NHNNQE--INYDS-PRGGV--------SVITEKGDITTS--YLLIQRASI 227
            .:..:: |.|     :|..:|  ::||| .|.|.        :.:...|||:.:  .:.:|....
Mouse   190 EEKRVTKVNWMFSSGSHTEEETVLSYDSNMRSGKFQSLGRFRNRVDLTGDISRNDGSIKLQTVKE 254

  Fly   228 ADSGQYTC---LPSNANSKSVNVHILKGD 253
            :|.|.|||   :....:.|::.:|:::.:
Mouse   255 SDQGIYTCSIYVGKLESRKTIVLHVVQDE 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr21NP_001163838.2 Ig 71..149 CDD:299845 18/89 (20%)
IG_like 71..140 CDD:214653 17/80 (21%)
IG_like 162..249 CDD:214653 24/109 (22%)
IGc2 169..242 CDD:197706 22/94 (23%)
JamlXP_006510445.4 V-set 55..165 CDD:369466 21/104 (20%)
V-set 167..280 CDD:369466 25/112 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5499
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.