DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr21 and Lsamp

DIOPT Version :9

Sequence 1:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster
Sequence 2:XP_030104997.1 Gene:Lsamp / 268890 MGIID:1261760 Length:392 Species:Mus musculus


Alignment Length:232 Identity:54/232 - (23%)
Similarity:103/232 - (44%) Gaps:39/232 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ENIVPMKRV-LDRGPYFDTSATKNVTSLVGITGHLNCRIKNLGNKTVSWIRHRDLHLLTVSESTY 101
            |..:|::.| .:||       |.|:|...|.|..|.|.:::..:| |:|:....  ::......:
Mouse    55 EEGLPVRSVDFNRG-------TDNITVRQGDTAILRCVVEDKNSK-VAWLNRSG--IIFAGHDKW 109

  Fly   102 TSDQRFTSIYNKQTGDWSLQIKFPQLRDSGIYECQVSTTPPVGYTMVFSVVE---PITSILGGPE 163
            :.|.| ..:..:...::||:|:...:.|.|.|.|.|.|......:.|:.:|:   .|::|  ..:
Mouse   110 SLDPR-VELEKRHALEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNI--SSD 171

  Fly   164 IYIDLGSTVNLTCVIKHLPDPPISVQWNHNNQEINYDSPRGGVSVITEKGDITTSYLLIQRASIA 228
            :.::.||.|.|.|:....|:|.|:  |.|             ::.:..:.:....||.|...:..
Mouse   172 VTVNEGSNVTLVCMANGRPEPVIT--WRH-------------LTPLGREFEGEEEYLEILGITRE 221

  Fly   229 DSGQYTCLPSN----ANSKSVNVHILKGDHPAAVQKS 261
            .||:|.|..:|    |:.|.|.|.:   ::|..:.:|
Mouse   222 QSGKYECKAANEVSSADVKQVKVTV---NYPPTITES 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr21NP_001163838.2 Ig 71..149 CDD:299845 16/77 (21%)
IG_like 71..140 CDD:214653 15/68 (22%)
IG_like 162..249 CDD:214653 22/90 (24%)
IGc2 169..242 CDD:197706 19/76 (25%)
LsampXP_030104997.1 Ig 69..159 CDD:386229 22/93 (24%)
Ig_3 163..232 CDD:372822 19/85 (22%)
Ig_3 250..325 CDD:372822 1/6 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.