DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr21 and CADM2

DIOPT Version :9

Sequence 1:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster
Sequence 2:XP_016861551.1 Gene:CADM2 / 253559 HGNCID:29849 Length:449 Species:Homo sapiens


Alignment Length:198 Identity:48/198 - (24%)
Similarity:72/198 - (36%) Gaps:30/198 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LDRGPYFDTSATKNVTSLVGITGHLNCRIKNLGNKTVSWIRHRDLHLLTVSESTYTSDQRF---- 107
            |.:|.......|:|||.:.|.|..|.||:....|.::.|..       ...::.|..|::.    
Human    32 LHQGSQGQFPLTQNVTVVEGGTAILTCRVDQNDNTSLQWSN-------PAQQTLYFDDKKALRDN 89

  Fly   108 -TSIYNKQTGDWSLQIKFPQLRDSGIYECQVSTTP---PVGYTMVFSVVE-PITSILGGPEIYID 167
             ..:......:.|:.:....|.|.|.|.|.:.|.|   ...|..|..|.| |..|....|.:..|
Human    90 RIELVRASWHELSISVSDVSLSDEGQYTCSLFTMPVKTSKAYLTVLGVPEKPQISGFSSPVMEGD 154

  Fly   168 LGSTVNLTCVIKHLPDPPISVQWNHNNQEINYDSPRGGVSVITE----KGDITTSYLLIQRASIA 228
            |   :.|||.... ..|...::|..|::||.      .|..:.|    :...|.|..|..|...:
Human   155 L---MQLTCKTSG-SKPAADIRWFKNDKEIK------DVKYLKEEDANRKTFTVSSTLDFRVDRS 209

  Fly   229 DSG 231
            |.|
Human   210 DDG 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr21NP_001163838.2 Ig 71..149 CDD:299845 16/85 (19%)
IG_like 71..140 CDD:214653 13/73 (18%)
IG_like 162..249 CDD:214653 19/74 (26%)
IGc2 169..242 CDD:197706 16/67 (24%)
CADM2XP_016861551.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5236
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.