DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr21 and IGSF9B

DIOPT Version :9

Sequence 1:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001264214.1 Gene:IGSF9B / 22997 HGNCID:32326 Length:1437 Species:Homo sapiens


Alignment Length:242 Identity:56/242 - (23%)
Similarity:92/242 - (38%) Gaps:61/242 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 NVTVTDL------------YLISENIVPMKRVLDRGPYFDTSATKNVTSLVGITGHLNCRIKNL- 78
            ::|||.:            |.|....|....:|.:||.|..|..:|:|..:.....|.||.:.. 
Human   192 SLTVTSVSREDRGAYTCRAYSIQGEAVHTTHLLVQGPPFIVSPPENITVNISQDALLTCRAEAYP 256

  Fly    79 GNKTVSWIRHRDLHLLTVSESTYTSDQRFTSIYNKQTGDWSLQIKF------------PQLRDSG 131
            ||.|.:|               |..|:   ::|.:  .|..|:::.            |:  |||
Human   257 GNLTYTW---------------YWQDE---NVYFQ--NDLKLRVRILIDGTLIIFRVKPE--DSG 299

  Fly   132 IYEC----QVSTTPPVGYTMVFSVVEPITSILGGPEIYIDLGSTVNLTCVIKHLPDPPISVQWNH 192
            .|.|    .:..:|..  :...:|..|...:...|.||:.:|....:.|.:...| |...|:||.
Human   300 KYTCVPSNSLGRSPSA--SAYLTVQYPARVLNMPPVIYVPVGIHGYIRCPVDAEP-PATVVKWNK 361

  Fly   193 NNQEINYDSPRGGVSVITEKGDITTSYLLIQRASIADSGQYTCLPSN 239
            :.:.:..:...|.  .:.|.|.|.     |:.|:....|.|||:|.|
Human   362 DGRPLQVEKNLGW--TLMEDGSIR-----IEEATEEALGTYTCVPYN 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr21NP_001163838.2 Ig 71..149 CDD:299845 19/94 (20%)
IG_like 71..140 CDD:214653 18/85 (21%)
IG_like 162..249 CDD:214653 22/78 (28%)
IGc2 169..242 CDD:197706 19/71 (27%)
IGSF9BNP_001264214.1 IG_like 30..115 CDD:214653
Ig 41..115 CDD:143165
I-set 139..225 CDD:254352 6/32 (19%)
IGc2 153..210 CDD:197706 3/17 (18%)
I-set 229..321 CDD:254352 23/115 (20%)
Ig 235..321 CDD:299845 21/109 (19%)
IG_like 331..414 CDD:214653 22/79 (28%)
Ig <353..414 CDD:299845 16/56 (29%)
IG_like 426..505 CDD:214653
Ig 442..505 CDD:299845
FN3 510..601 CDD:238020
FN3 617..699 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 758..817
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 911..1081
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.