| Sequence 1: | NP_001163838.2 | Gene: | dpr21 / 8674044 | FlyBaseID: | FBgn0260995 | Length: | 282 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_689957.3 | Gene: | SDK1 / 221935 | HGNCID: | 19307 | Length: | 2213 | Species: | Homo sapiens |
| Alignment Length: | 242 | Identity: | 62/242 - (25%) |
|---|---|---|---|
| Similarity: | 99/242 - (40%) | Gaps: | 39/242 - (16%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 31 TDLYLISENIVPMKRVLDRGPYFDTSATKNVTSLVGITGHLNCRIKNLGNKTVSWIRHRDLHLLT 95
Fly 96 VSESTYTSDQRFTSIYNKQTGDWSLQIKFPQLRDSGIYECQVSTTPPVGYTMVFSVVEPITSILG 160
Fly 161 GPEIYIDL-GSTVNLTCVIKHLPDPPISVQ--WNHNNQEINYDSPRGGVSVITEKGDITTSYLLI 222
Fly 223 QRASIADSGQYTC--LPSNAN-SKSVNVHILKGDHPAAVQKSHLLVS 266 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr21 | NP_001163838.2 | Ig | 71..149 | CDD:299845 | 16/77 (21%) |
| IG_like | 71..140 | CDD:214653 | 15/68 (22%) | ||
| IG_like | 162..249 | CDD:214653 | 24/92 (26%) | ||
| IGc2 | 169..242 | CDD:197706 | 21/77 (27%) | ||
| SDK1 | NP_689957.3 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..73 | ||
| I-set | 104..188 | CDD:254352 | |||
| Ig | 122..176 | CDD:143165 | |||
| Ig | 219..265 | CDD:299845 | |||
| IGc2 | 312..364 | CDD:197706 | |||
| I-set | 386..475 | CDD:254352 | 3/5 (60%) | ||
| Ig | 404..472 | CDD:143165 | 1/2 (50%) | ||
| I-set | 480..570 | CDD:254352 | 24/109 (22%) | ||
| Ig | 494..570 | CDD:299845 | 18/85 (21%) | ||
| I-set | 575..664 | CDD:254352 | 26/97 (27%) | ||
| Ig | 580..664 | CDD:299845 | 24/92 (26%) | ||
| FN3 | 668..759 | CDD:238020 | 5/14 (36%) | ||
| fn3 | 771..857 | CDD:278470 | |||
| FN3 | 872..967 | CDD:238020 | |||
| FN3 | 972..1054 | CDD:238020 | |||
| FN3 | 1070..1166 | CDD:238020 | |||
| FN3 | 1176..1271 | CDD:238020 | |||
| fn3 | 1279..1365 | CDD:278470 | |||
| FN3 | 1378..1471 | CDD:238020 | |||
| FN3 | 1477..1572 | CDD:238020 | |||
| FN3 | 1580..1694 | CDD:238020 | |||
| FN3 | 1704..1797 | CDD:238020 | |||
| FN3 | 1802..1883 | CDD:238020 | |||
| FN3 | 1903..1996 | CDD:238020 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 2075..2098 | ||||
| PDZ-binding. /evidence=ECO:0000250|UniProtKB:Q6V4S5 | 2207..2213 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||