DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr21 and CADM4

DIOPT Version :9

Sequence 1:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_660339.1 Gene:CADM4 / 199731 HGNCID:30825 Length:388 Species:Homo sapiens


Alignment Length:302 Identity:68/302 - (22%)
Similarity:118/302 - (39%) Gaps:79/302 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LKETCPQHFRENVTVTDLYLISENIVPMKRVLDRGPYFDTSATKN-------VTSLV-------- 65
            |:|..|:..|  :.::|           .|:.|.|.||....|::       :|.||        
Human    79 LEEFSPRRVR--IRLSD-----------ARLEDEGGYFCQLYTEDTHHQIATLTVLVAPENPVVE 130

  Fly    66 ----GITG---HLNCRI-KNLGNKTVSWIRHRDLHLLTVSESTYTSDQRFTSIYNKQTGD-WS-- 119
                .:.|   .|:|.: ::....|:.|.|.|. .|..||.|             ::.|. ||  
Human   131 VREQAVEGGEVELSCLVPRSRPAATLRWYRDRK-ELKGVSSS-------------QENGKVWSVA 181

  Fly   120 --LQIKFPQLRDSGIYECQVSTTP-PVGYT----MVFSVVEPITSILGGPEIYIDLGSTVNLTCV 177
              ::.:..:..|.||..|:..... |.|::    .|..|....|:.:...:..:..|.|:.|||.
Human   182 STVRFRVDRKDDGGIIICEAQNQALPSGHSKQTQYVLDVQYSPTARIHASQAVVREGDTLVLTCA 246

  Fly   178 IKHLPDPPISVQWNHNNQEINYDSPRGGVSVITEKGDITTSYLLIQRASIADSGQYTCLPSNANS 242
            :...|.|. .::||..|:.            :.|:.:.....|.:.....||:|.|||..||.:.
Human   247 VTGNPRPN-QIRWNRGNES------------LPERAEAVGETLTLPGLVSADNGTYTCEASNKHG 298

  Fly   243 KSVNVHILKGDHPAAVQKS-----HLLVSELLS-LCFLQICL 278
            .:..:::|....|.||.::     :.:|..:|: |.||.||:
Human   299 HARALYVLVVYDPGAVVEAQTSVPYAIVGGILALLVFLIICV 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr21NP_001163838.2 Ig 71..149 CDD:299845 19/88 (22%)
IG_like 71..140 CDD:214653 17/74 (23%)
IG_like 162..249 CDD:214653 20/86 (23%)
IGc2 169..242 CDD:197706 20/72 (28%)
CADM4NP_660339.1 Ig 29..120 CDD:416386 11/53 (21%)
FR1 29..45 CDD:409353
Ig strand A' 30..36 CDD:409353
Ig strand B 38..46 CDD:409353
CDR1 46..51 CDD:409353
FR2 52..59 CDD:409353
Ig strand C 52..58 CDD:409353
CDR2 60..71 CDD:409353
Ig strand C' 62..66 CDD:409353
Ig strand C' 68..71 CDD:409353
FR3 72..107 CDD:409353 10/40 (25%)
Ig strand D 76..83 CDD:409353 2/3 (67%)
Ig strand E 86..92 CDD:409353 1/7 (14%)
Ig strand F 99..107 CDD:409353 3/7 (43%)
CDR3 108..111 CDD:409353 1/2 (50%)
Ig strand G 111..120 CDD:409353 0/8 (0%)
FR4 113..120 CDD:409353 0/6 (0%)
IgI_2_Necl-4 121..220 CDD:409468 23/112 (21%)
Ig strand B 141..145 CDD:409468 1/3 (33%)
Ig strand C 155..159 CDD:409468 1/3 (33%)
Ig strand E 182..186 CDD:409468 0/3 (0%)
Ig strand F 196..201 CDD:409468 2/4 (50%)
Ig strand G 213..216 CDD:409468 0/2 (0%)
Ig_3 224..295 CDD:404760 19/83 (23%)
Ig strand A' 231..235 CDD:409353 0/3 (0%)
Ig strand B 241..248 CDD:409353 3/6 (50%)
Ig strand C 255..260 CDD:409353 1/4 (25%)
Ig strand C' 262..264 CDD:409353 1/1 (100%)
Ig strand E 274..280 CDD:409353 1/5 (20%)
Ig strand F 287..294 CDD:409353 4/6 (67%)
Ig strand G 300..308 CDD:409353 1/7 (14%)
4.1m 344..362 CDD:128590
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5236
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.