DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr21 and CADM4

DIOPT Version :10

Sequence 1:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_660339.1 Gene:CADM4 / 199731 HGNCID:30825 Length:388 Species:Homo sapiens


Alignment Length:302 Identity:68/302 - (22%)
Similarity:118/302 - (39%) Gaps:79/302 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LKETCPQHFRENVTVTDLYLISENIVPMKRVLDRGPYFDTSATKN-------VTSLV-------- 65
            |:|..|:..|  :.::|           .|:.|.|.||....|::       :|.||        
Human    79 LEEFSPRRVR--IRLSD-----------ARLEDEGGYFCQLYTEDTHHQIATLTVLVAPENPVVE 130

  Fly    66 ----GITG---HLNCRI-KNLGNKTVSWIRHRDLHLLTVSESTYTSDQRFTSIYNKQTGD-WS-- 119
                .:.|   .|:|.: ::....|:.|.|.|. .|..||.|             ::.|. ||  
Human   131 VREQAVEGGEVELSCLVPRSRPAATLRWYRDRK-ELKGVSSS-------------QENGKVWSVA 181

  Fly   120 --LQIKFPQLRDSGIYECQVSTTP-PVGYT----MVFSVVEPITSILGGPEIYIDLGSTVNLTCV 177
              ::.:..:..|.||..|:..... |.|::    .|..|....|:.:...:..:..|.|:.|||.
Human   182 STVRFRVDRKDDGGIIICEAQNQALPSGHSKQTQYVLDVQYSPTARIHASQAVVREGDTLVLTCA 246

  Fly   178 IKHLPDPPISVQWNHNNQEINYDSPRGGVSVITEKGDITTSYLLIQRASIADSGQYTCLPSNANS 242
            :...|.|. .::||..|:.            :.|:.:.....|.:.....||:|.|||..||.:.
Human   247 VTGNPRPN-QIRWNRGNES------------LPERAEAVGETLTLPGLVSADNGTYTCEASNKHG 298

  Fly   243 KSVNVHILKGDHPAAVQKS-----HLLVSELLS-LCFLQICL 278
            .:..:::|....|.||.::     :.:|..:|: |.||.||:
Human   299 HARALYVLVVYDPGAVVEAQTSVPYAIVGGILALLVFLIICV 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr21NP_001163838.2 Ig 71..149 CDD:472250 19/88 (22%)
Ig strand C 82..86 CDD:409353 1/3 (33%)
Ig strand E 118..122 CDD:409353 2/7 (29%)
Ig strand F 132..137 CDD:409353 2/4 (50%)
Ig 169..249 CDD:472250 20/79 (25%)
Ig strand B 172..176 CDD:409353 1/3 (33%)
Ig strand C 187..191 CDD:409353 0/3 (0%)
Ig strand E 218..222 CDD:409353 1/3 (33%)
Ig strand F 232..237 CDD:409353 3/4 (75%)
Ig strand G 246..249 CDD:409353 0/2 (0%)
CADM4NP_660339.1 Ig 29..120 CDD:472250 11/53 (21%)
Ig strand B 40..44 CDD:409353
Ig strand C 53..57 CDD:409353
Ig strand E 87..91 CDD:409353 1/5 (20%)
Ig strand F 101..106 CDD:409353 2/4 (50%)
Ig strand G 113..116 CDD:409353 0/2 (0%)
IgI_2_Necl-4 121..220 CDD:409468 23/112 (21%)
Ig strand A 121..124 CDD:409468 2/2 (100%)
Ig strand A' 127..131 CDD:409468 0/3 (0%)
Ig strand B 139..149 CDD:409468 2/9 (22%)
Ig strand C 152..161 CDD:409468 2/8 (25%)
Ig strand C' 162..165 CDD:409468 1/3 (33%)
Ig strand D 167..174 CDD:409468 3/19 (16%)
Ig strand E 177..187 CDD:409468 2/9 (22%)
Ig strand F 195..203 CDD:409468 3/7 (43%)
Ig strand G 212..219 CDD:409468 1/6 (17%)
Ig_3 224..295 CDD:464046 19/83 (23%)
4.1m 344..362 CDD:128590
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.