DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr21 and Opcml

DIOPT Version :10

Sequence 1:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster
Sequence 2:XP_017450901.1 Gene:Opcml / 116597 RGDID:620635 Length:354 Species:Rattus norvegicus


Alignment Length:264 Identity:60/264 - (22%)
Similarity:108/264 - (40%) Gaps:46/264 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VFLTFRIFLCILILKETCPQHFRENVTVTDLYLISENIVPMKRVLDRGPYFDTSATKNVTSLVGI 67
            :||.::   |:::            |::..|:|:... ||::    .|......|..|||...|.
  Rat     7 LFLPWK---CLVV------------VSLRLLFLVPTG-VPVR----SGDATFPKAMDNVTVRQGE 51

  Fly    68 TGHLNCRIKNLGNKTVSWIRHRDLHLLTVSESTYTSDQRFTSIYNKQTGDWSLQIKFPQLRDSGI 132
            :..|.|.|.:...: |:|:....  :|......::.|.|...:.|..| .:|:.|:...:.|.|.
  Rat    52 SATLRCTIDDRVTR-VAWLNRST--ILYAGNDKWSIDPRVIILVNTPT-QYSIMIQNVDVYDEGP 112

  Fly   133 YECQVSTTPPVGYTMVFSVVEPITSILG-GPEIYIDLGSTVNLTCVIKHLPDPPISVQWNHNNQE 196
            |.|.|.|......:.|..:|:....|:. ..:|.::.||:|.|.|:....|:|  :|.|.|.   
  Rat   113 YTCSVQTDNHPKTSRVHLIVQVPPQIMNISSDITVNEGSSVTLLCLAIGRPEP--TVTWRHL--- 172

  Fly   197 INYDSPRGGVSVITEKGDITTSYLLIQRASIADSGQYTCLPSN----ANSKSVNVHILKGDHPAA 257
                |.:.|...::|     ..||.|.......||:|.|...|    .:.:.|.:.:   ::|..
  Rat   173 ----SVKEGQGFVSE-----DEYLEISDIKRDQSGEYECSALNDVAAPDVRKVKITV---NYPPY 225

  Fly   258 VQKS 261
            :.|:
  Rat   226 ISKA 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr21NP_001163838.2 Ig 71..149 CDD:472250 18/77 (23%)
Ig strand C 82..86 CDD:409353 1/3 (33%)
Ig strand E 118..122 CDD:409353 1/3 (33%)
Ig strand F 132..137 CDD:409353 2/4 (50%)
Ig 169..249 CDD:472250 22/83 (27%)
Ig strand B 172..176 CDD:409353 2/3 (67%)
Ig strand C 187..191 CDD:409353 1/3 (33%)
Ig strand E 218..222 CDD:409353 2/3 (67%)
Ig strand F 232..237 CDD:409353 2/4 (50%)
Ig strand G 246..249 CDD:409353 0/2 (0%)
OpcmlXP_017450901.1 Ig 44..132 CDD:472250 23/91 (25%)
Ig strand B 53..57 CDD:409353 1/3 (33%)
Ig strand C 65..69 CDD:409353 1/4 (25%)
Ig strand E 98..102 CDD:409353 1/3 (33%)
Ig strand F 112..117 CDD:409353 2/4 (50%)
Ig strand G 125..128 CDD:409353 0/2 (0%)
Ig_3 135..206 CDD:464046 22/84 (26%)
Ig 224..312 CDD:472250 1/6 (17%)
Ig strand B 240..244 CDD:409353
Ig strand C 253..257 CDD:409353
Ig strand E 279..283 CDD:409353
Ig strand F 293..298 CDD:409353
Ig strand G 306..309 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.