DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr21 and ntm

DIOPT Version :9

Sequence 1:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster
Sequence 2:XP_004916061.1 Gene:ntm / 100492453 XenbaseID:XB-GENE-6045425 Length:374 Species:Xenopus tropicalis


Alignment Length:186 Identity:51/186 - (27%)
Similarity:77/186 - (41%) Gaps:24/186 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 ATKNVTSLVGITGHLNCRIKNLGNKTVSWIRHRDLHLLTVSESTYTSDQRFTSIYNKQTGDWSLQ 121
            |..|||...|.:..|.|.:.|...: |:|:....  :|......::.|.|...:.|.:: .:|::
 Frog    42 AMDNVTVRQGDSAILRCTVDNRVTR-VAWLNRST--ILYTGNDKWSIDPRVVLLANTKS-QYSIE 102

  Fly   122 IKFPQLRDSGIYECQVSTTPPVGYTMVFSVVEPITSILG-GPEIYIDLGSTVNLTCVIKHLPDPP 185
            |:...:.|.|.|.|.|.|......:.|..:|:....|:. ...|.::.||.|:|.|:....|:| 
 Frog   103 IQNVDIYDEGPYTCSVQTDNHPKTSRVHLIVQVPPRIVDISSSIAVNEGSNVSLICIANGRPEP- 166

  Fly   186 ISVQWNHNNQEINYDSP--RGGVSVITEKGDITTSYLLIQRASIADSGQYTCLPSN 239
             .|.|       .|.||  ||.||        ...||.|...:...||.|.|..||
 Frog   167 -VVNW-------RYLSPKARGFVS--------EDEYLEITGITREQSGIYECSASN 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr21NP_001163838.2 Ig 71..149 CDD:299845 17/77 (22%)
IG_like 71..140 CDD:214653 16/68 (24%)
IG_like 162..249 CDD:214653 26/80 (33%)
IGc2 169..242 CDD:197706 25/73 (34%)
ntmXP_004916061.1 Ig 45..133 CDD:299845 22/91 (24%)
IG_like 45..133 CDD:214653 22/91 (24%)
IG_like 143..220 CDD:214653 26/81 (32%)
IGc2 150..209 CDD:197706 25/74 (34%)
ig 227..311 CDD:278476
IG_like 230..311 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.