DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr21 and ntm

DIOPT Version :10

Sequence 1:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster
Sequence 2:XP_004916061.1 Gene:ntm / 100492453 XenbaseID:XB-GENE-6045425 Length:374 Species:Xenopus tropicalis


Alignment Length:186 Identity:51/186 - (27%)
Similarity:77/186 - (41%) Gaps:24/186 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 ATKNVTSLVGITGHLNCRIKNLGNKTVSWIRHRDLHLLTVSESTYTSDQRFTSIYNKQTGDWSLQ 121
            |..|||...|.:..|.|.:.|...: |:|:....  :|......::.|.|...:.|.:: .:|::
 Frog    42 AMDNVTVRQGDSAILRCTVDNRVTR-VAWLNRST--ILYTGNDKWSIDPRVVLLANTKS-QYSIE 102

  Fly   122 IKFPQLRDSGIYECQVSTTPPVGYTMVFSVVEPITSILG-GPEIYIDLGSTVNLTCVIKHLPDPP 185
            |:...:.|.|.|.|.|.|......:.|..:|:....|:. ...|.::.||.|:|.|:....|:| 
 Frog   103 IQNVDIYDEGPYTCSVQTDNHPKTSRVHLIVQVPPRIVDISSSIAVNEGSNVSLICIANGRPEP- 166

  Fly   186 ISVQWNHNNQEINYDSP--RGGVSVITEKGDITTSYLLIQRASIADSGQYTCLPSN 239
             .|.|       .|.||  ||.||        ...||.|...:...||.|.|..||
 Frog   167 -VVNW-------RYLSPKARGFVS--------EDEYLEITGITREQSGIYECSASN 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr21NP_001163838.2 Ig 71..149 CDD:472250 17/77 (22%)
Ig strand C 82..86 CDD:409353 1/3 (33%)
Ig strand E 118..122 CDD:409353 1/3 (33%)
Ig strand F 132..137 CDD:409353 2/4 (50%)
Ig 169..249 CDD:472250 25/73 (34%)
Ig strand B 172..176 CDD:409353 2/3 (67%)
Ig strand C 187..191 CDD:409353 1/3 (33%)
Ig strand E 218..222 CDD:409353 2/3 (67%)
Ig strand F 232..237 CDD:409353 2/4 (50%)
Ig strand G 246..249 CDD:409353
ntmXP_004916061.1 Ig 45..133 CDD:472250 22/91 (24%)
Ig strand B 54..58 CDD:409353 1/3 (33%)
Ig strand C 66..70 CDD:409353 1/4 (25%)
Ig strand E 99..103 CDD:409353 1/3 (33%)
Ig strand F 113..118 CDD:409353 2/4 (50%)
Ig strand G 126..129 CDD:409353 0/2 (0%)
Ig_3 136..206 CDD:464046 25/86 (29%)
ig 227..311 CDD:395002
Ig strand B 240..244 CDD:409353
Ig strand C 253..257 CDD:409353
Ig strand E 279..283 CDD:409353
Ig strand F 293..298 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.