| Sequence 1: | NP_001163838.2 | Gene: | dpr21 / 8674044 | FlyBaseID: | FBgn0260995 | Length: | 282 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_005157551.1 | Gene: | dscaml1 / 100002762 | -ID: | - | Length: | 2158 | Species: | Danio rerio |
| Alignment Length: | 201 | Identity: | 53/201 - (26%) |
|---|---|---|---|
| Similarity: | 85/201 - (42%) | Gaps: | 31/201 - (15%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 45 RVLDRGPYFDTSATKNVTSLVGITGHLNCRIKNLGNKTVSWIRHRDLHLLTVSESTYTSDQRFTS 109
Fly 110 IYNKQTGDWSLQIKFPQLR---DSGIYECQVSTTPPVGYTMVFSV---VEPITSILGGPEIYIDL 168
Fly 169 GSTVNLTCVIKHLPDPPISVQWNHNNQEINYDSPRGGVSVITEKGDITTSYLLIQRASIADSGQY 233
Fly 234 TCLPSN 239 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr21 | NP_001163838.2 | Ig | 71..149 | CDD:299845 | 17/80 (21%) |
| IG_like | 71..140 | CDD:214653 | 16/71 (23%) | ||
| IG_like | 162..249 | CDD:214653 | 25/78 (32%) | ||
| IGc2 | 169..242 | CDD:197706 | 24/71 (34%) | ||
| dscaml1 | XP_005157551.1 | IG_like | 112..184 | CDD:214653 | |
| Ig | 112..183 | CDD:143165 | |||
| Ig | 194..287 | CDD:299845 | |||
| I-set | 302..380 | CDD:254352 | |||
| IGc2 | 309..370 | CDD:197706 | |||
| IGc2 | 399..458 | CDD:197706 | |||
| I-set | 477..571 | CDD:254352 | 1/2 (50%) | ||
| Ig | 477..567 | CDD:299845 | |||
| IG_like | 581..662 | CDD:214653 | 21/96 (22%) | ||
| IGc2 | 588..646 | CDD:197706 | 16/73 (22%) | ||
| Ig | 684..751 | CDD:143165 | 23/66 (35%) | ||
| IG_like | 686..756 | CDD:214653 | 23/64 (36%) | ||
| I-set | 760..855 | CDD:254352 | |||
| Ig7_DSCAM | 778..855 | CDD:143211 | |||
| IG_like | 865..956 | CDD:214653 | |||
| Ig | 873..963 | CDD:299845 | |||
| FN3 | 959..1053 | CDD:238020 | |||
| FN3 | 1060..1157 | CDD:238020 | |||
| FN3 | 1165..1271 | CDD:238020 | |||
| FN3 | 1276..1367 | CDD:238020 | |||
| IGc2 | 1392..1455 | CDD:197706 | |||
| FN3 | 1486..1559 | CDD:238020 | |||
| FN3 | 1573..1649 | CDD:238020 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||