DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42456 and DPM2

DIOPT Version :9

Sequence 1:NP_001163338.1 Gene:CG42456 / 8674033 FlyBaseID:FBgn0259933 Length:81 Species:Drosophila melanogaster
Sequence 2:NP_003854.1 Gene:DPM2 / 8818 HGNCID:3006 Length:84 Species:Homo sapiens


Alignment Length:71 Identity:25/71 - (35%)
Similarity:38/71 - (53%) Gaps:5/71 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IILISAIAVFFYYFFWVAVLPFMLIDEGNPIRLFFPPLKYAFIVPTVFGVIFLGGIAAFSFYHIW 74
            ::.:|.| :|.||..||.:|||  ||..:.|..:|.|..||..:|...|::.|..:..|..|.: 
Human    13 LVAVSLI-IFTYYTAWVILLPF--IDSQHVIHKYFLPRAYAVAIPLAAGLLLLLFVGLFISYVM- 73

  Fly    75 SLRVKR 80
             |:.||
Human    74 -LKTKR 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42456NP_001163338.1 DPM2 8..68 CDD:399936 20/57 (35%)
DPM2NP_003854.1 DPM2 5..78 CDD:284664 23/69 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006485
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105019
Panther 1 1.100 - - LDO PTHR15039
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.