DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42456 and DPMS2

DIOPT Version :9

Sequence 1:NP_001163338.1 Gene:CG42456 / 8674033 FlyBaseID:FBgn0259933 Length:81 Species:Drosophila melanogaster
Sequence 2:NP_001320932.1 Gene:DPMS2 / 843775 AraportID:AT1G74340 Length:80 Species:Arabidopsis thaliana


Alignment Length:60 Identity:24/60 - (40%)
Similarity:36/60 - (60%) Gaps:4/60 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ILISAI--AVFFYYFFWVAVLPFMLIDEGNPIRLFFPPLKYAFIVPTVFGVIFLGGIAAF 68
            :|:|:|  ::|.||.|||.:|||  :|..:.|..:|.|..||.:||...|:..|..|:.|
plant    10 LLLSSISLSIFTYYTFWVIILPF--VDSDHFIHKYFLPQDYAILVPVFAGIALLSLISVF 67

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42456NP_001163338.1 DPM2 8..68 CDD:399936 23/58 (40%)
DPMS2NP_001320932.1 DPM2 4..79 CDD:399936 24/60 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006485
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105019
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.