DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dpm2 and DPMS2

DIOPT Version :10

Sequence 1:NP_001163338.1 Gene:Dpm2 / 8674033 FlyBaseID:FBgn0259933 Length:81 Species:Drosophila melanogaster
Sequence 2:NP_177574.1 Gene:DPMS2 / 843775 AraportID:AT1G74340 Length:80 Species:Arabidopsis thaliana


Alignment Length:60 Identity:24/60 - (40%)
Similarity:36/60 - (60%) Gaps:4/60 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ILISAI--AVFFYYFFWVAVLPFMLIDEGNPIRLFFPPLKYAFIVPTVFGVIFLGGIAAF 68
            :|:|:|  ::|.||.|||.:|||  :|..:.|..:|.|..||.:||...|:..|..|:.|
plant    10 LLLSSISLSIFTYYTFWVIILPF--VDSDHFIHKYFLPQDYAILVPVFAGIALLSLISVF 67

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dpm2NP_001163338.1 PIG-P 8..68 CDD:480716 23/58 (40%)
DPMS2NP_177574.1 DPM2 4..78 CDD:462138 24/60 (40%)

Return to query results.
Submit another query.