powered by:
Protein Alignment CG42456 and DPMS2
DIOPT Version :9
Sequence 1: | NP_001163338.1 |
Gene: | CG42456 / 8674033 |
FlyBaseID: | FBgn0259933 |
Length: | 81 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001320932.1 |
Gene: | DPMS2 / 843775 |
AraportID: | AT1G74340 |
Length: | 80 |
Species: | Arabidopsis thaliana |
Alignment Length: | 60 |
Identity: | 24/60 - (40%) |
Similarity: | 36/60 - (60%) |
Gaps: | 4/60 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 11 ILISAI--AVFFYYFFWVAVLPFMLIDEGNPIRLFFPPLKYAFIVPTVFGVIFLGGIAAF 68
:|:|:| ::|.||.|||.:||| :|..:.|..:|.|..||.:||...|:..|..|:.|
plant 10 LLLSSISLSIFTYYTFWVIILPF--VDSDHFIHKYFLPQDYAILVPVFAGIALLSLISVF 67
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG42456 | NP_001163338.1 |
DPM2 |
8..68 |
CDD:399936 |
23/58 (40%) |
DPMS2 | NP_001320932.1 |
DPM2 |
4..79 |
CDD:399936 |
24/60 (40%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0006485 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_105019 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.810 |
|
Return to query results.
Submit another query.