DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42456 and dpm2

DIOPT Version :9

Sequence 1:NP_001163338.1 Gene:CG42456 / 8674033 FlyBaseID:FBgn0259933 Length:81 Species:Drosophila melanogaster
Sequence 2:NP_595676.1 Gene:dpm2 / 2540708 PomBaseID:SPBC21B10.11 Length:72 Species:Schizosaccharomyces pombe


Alignment Length:75 Identity:24/75 - (32%)
Similarity:36/75 - (48%) Gaps:8/75 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IILISAIAVFFYYFFWVAVLPFMLIDEGNPIRLFFPPLKYAFIVPT---VFGVIFLGGIAAFSFY 71
            |:.||. |.|.||..||.::||  :|..|..:..|...::|..:|.   :||:..:|...  |..
pombe     2 IVYIST-AAFLYYTIWVLIMPF--VDNMNISQKLFLDREWAITIPVAVMLFGICLIGTFV--SLL 61

  Fly    72 HIWSLRVKRD 81
            .|.|.:.|.|
pombe    62 MIKSSKKKSD 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42456NP_001163338.1 DPM2 8..68 CDD:399936 19/60 (32%)
dpm2NP_595676.1 DPM2 1..69 CDD:284664 22/71 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006485
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105019
Panther 1 1.100 - - LDO PTHR15039
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.