DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dpm2 and dpm2

DIOPT Version :10

Sequence 1:NP_001163338.1 Gene:Dpm2 / 8674033 FlyBaseID:FBgn0259933 Length:81 Species:Drosophila melanogaster
Sequence 2:NP_595676.1 Gene:dpm2 / 2540708 PomBaseID:SPBC21B10.11 Length:72 Species:Schizosaccharomyces pombe


Alignment Length:75 Identity:24/75 - (32%)
Similarity:36/75 - (48%) Gaps:8/75 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IILISAIAVFFYYFFWVAVLPFMLIDEGNPIRLFFPPLKYAFIVPT---VFGVIFLGGIAAFSFY 71
            |:.||. |.|.||..||.::||  :|..|..:..|...::|..:|.   :||:..:|...  |..
pombe     2 IVYIST-AAFLYYTIWVLIMPF--VDNMNISQKLFLDREWAITIPVAVMLFGICLIGTFV--SLL 61

  Fly    72 HIWSLRVKRD 81
            .|.|.:.|.|
pombe    62 MIKSSKKKSD 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dpm2NP_001163338.1 PIG-P 8..68 CDD:480716 19/60 (32%)
dpm2NP_595676.1 DPM2 1..68 CDD:462138 22/70 (31%)

Return to query results.
Submit another query.